UQCRHL (NM_001089591) Human Recombinant Protein
CAT#: TP319881
Recombinant protein of human ubiquinol-cytochrome c reductase hinge protein-like (UQCRHL), 20 µg
View other "UQCRHL" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC219881 representing NM_001089591
Red=Cloning site Green=Tags(s) MGLEDEQKMLTESGDPEEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELYDEHVSSRSHTEEDCTEE LFDFLHAKDHCVAHKLFNNLK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 10.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001083060 |
Locus ID | 440567 |
UniProt ID | A0A096LP55 |
Refseq Size | 538 |
Cytogenetics | 1p36.21 |
Refseq ORF | 273 |
Summary | This gene has characteristics of a pseudogene derived from the UQCRH gene. However, there is still an open reading frame that could produce a protein of the same or nearly the same size as that of the UQCRH gene, so this gene is being called protein-coding for now. [provided by RefSeq, Jul 2008] |
Protein Pathways | Alzheimer's disease, Cardiac muscle contraction, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC421339 | UQCRHL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY421339 | Transient overexpression lysate of ubiquinol-cytochrome c reductase hinge protein-like (UQCRHL) |
CNY 3,080.00 |
|
PH319881 | UQCRHL MS Standard C13 and N15-labeled recombinant protein (NP_001083060) |
CNY 19,520.00 |