FGFR4 (NM_022963) Human Recombinant Protein
CAT#: TP319813
Recombinant protein of human fibroblast growth factor receptor 4 (FGFR4), transcript variant 2, 20 µg
View other "FGFR4" proteins (12)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC219813 representing NM_022963
Red=Cloning site Green=Tags(s) MRLLLALLGVLLSVPGPPVLSLEASEEVELEPCLAPSLEQQEQELTVALGQPVRLCCGRAERGGHWYKEG SRLAPAGRVRGWRGRLEIASFLPEDAGRYLCLARGSMIVLQNLTLITGDSLTSSNDDEDPKSHRDLSNRH SYPQQAPYWTHPQRMEKKLHAVPAGNTVKFRCPAAGNPTPTIRWLKDGQAFHGENRIGGIRLRHQHWSLV MESVVPSDRGTYTCLVENAVGSIRYNYLLDVLERSPHRPILQAGLPANTTAVVGSDVELLCKVYSDAQPH IQWLKHIVINGSSFGADGFPYVQVLKTADINSSEVEVLYLRNVSAEDAGEYTCLAGNSIGLSYQSAWLTV LPGTGRIPHLTCDSLTPAGRTKSPTLQFSLESGSSGKSSSSLVRGVRLSSSGPALLAGLVSLDLPLDPLW EFPRDRLVLGKPLGEGCFGQVVRAEAFGMDPARPDQASTVAVKMLKDNASDKDLADLVSEMEVMKLIGRH KNIINLLGVCTQEGPLYVIVECAAKGNLREFLRARRPPGPDLSPDGPRSSEGPLSFPVLVSCAYQVARGM QYLESRKCIHRDLAARNVLVTEDNVMKIADFGLARGVHHIDYYKKTSNGRLPVKWMAPEALFDRVYTHQS DVWSFGILLWEIFTLGGSPYPGIPVEELFSLLREGHRMDRPPHCPPELYGLMRECWHAAPSQRPTFKQLV EALDKVLLAVSEEYLDLRLTFGPYSPSGGDASSTCSSSDSVFSHDPLPLGSSSFPFGSGVQT myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 80.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_075252 |
Locus ID | 2264 |
UniProt ID | P22455, P22455-2 |
Refseq Size | 2807 |
Cytogenetics | 5q35.2 |
Refseq ORF | 2286 |
Synonyms | CD334; JTK2; TKF |
Summary | The protein encoded by this gene is a tyrosine kinase and cell surface receptor for fibroblast growth factors. The encoded protein is involved in the regulation of several pathways, including cell proliferation, cell differentiation, cell migration, lipid metabolism, bile acid biosynthesis, vitamin D metabolism, glucose uptake, and phosphate homeostasis. This protein consists of an extracellular region, composed of three immunoglobulin-like domains, a single hydrophobic membrane-spanning segment, and a cytoplasmic tyrosine kinase domain. The extracellular portion interacts with fibroblast growth factors, setting in motion a cascade of downstream signals, ultimately influencing mitogenesis and differentiation. [provided by RefSeq, Aug 2017] |
Protein Families | Druggable Genome, Protein Kinase |
Protein Pathways | Endocytosis, MAPK signaling pathway, Regulation of actin cytoskeleton |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400735 | FGFR4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC403876 | FGFR4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC411457 | FGFR4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC429711 | FGFR4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC431021 | FGFR4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY400735 | Transient overexpression lysate of fibroblast growth factor receptor 4 (FGFR4), transcript variant 1 |
CNY 3,080.00 |
|
LY403876 | Transient overexpression lysate of fibroblast growth factor receptor 4 (FGFR4), transcript variant 3 |
CNY 4,840.00 |
|
LY411457 | Transient overexpression lysate of fibroblast growth factor receptor 4 (FGFR4), transcript variant 2 |
CNY 4,840.00 |
|
LY429711 | Transient overexpression lysate of fibroblast growth factor receptor 4 (FGFR4), transcript variant 2 |
CNY 4,840.00 |
|
LY431021 | Transient overexpression lysate of fibroblast growth factor receptor 4 (FGFR4), transcript variant 3 |
CNY 4,840.00 |
|
PH319813 | FGFR4 MS Standard C13 and N15-labeled recombinant protein (NP_075252) |
CNY 19,520.00 |
|
TP700125 | Purified recombinant protein of human fibroblast growth factor receptor 4 (FGFR4), transcript variant 1, with C-terminal DDK/His tag, expressed in human cells, 20 µg |
CNY 6,650.00 |