IKZF3 (NM_183231) Human Recombinant Protein
CAT#: TP319750
Recombinant protein of human IKAROS family zinc finger 3 (Aiolos) (IKZF3), transcript variant 5, 20 µg
View other "IKZF3" proteins (11)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC219750 representing NM_183231
Red=Cloning site Green=Tags(s) MEDIQTNAELKSTQEQSVPAESAAVLNDYSLTKSHEMENVDSGEGPANEDEDIGDDSMKVKDEYSERDEN VLKSEPMGNAEEPEIPYSYSREYNEYENIKLERHVVSFDSSRPTSGKMNCDVCGLSCISFNVLMVHKRSH TASAEARHIKAEMGSERALVLDRLASNVAKRKSSMPQKFIGEKRHCFDVNYNSSYMYEKESELIQTRMMD QAINNAISYLGAEALRPLVQTPPAPTSEMVPVISSMYPIALTRAEMSNGAPQELEKKSIHLPEKSVPSER GLSPNNSGHDSTDTDSNHEERQNHIYQQNHMVLSRARNGMPLLKEVPRSYELLKPPPICPRDSVKVINKE GEVMDVYRCDHCRVLFLDYVMFTIHMGCHGFRDPFECNMCGYRSHDRYEFSSHIARGEHRALLK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 46.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_899054 |
Locus ID | 22806 |
UniProt ID | Q9UKT9 |
Refseq Size | 2152 |
Cytogenetics | 17q12-q21.1 |
Refseq ORF | 1242 |
Synonyms | AIO; AIOLOS; ZNFN1A3 |
Summary | This gene encodes a member of the Ikaros family of zinc-finger proteins. Three members of this protein family (Ikaros, Aiolos and Helios) are hematopoietic-specific transcription factors involved in the regulation of lymphocyte development. This gene product is a transcription factor that is important in the regulation of B lymphocyte proliferation and differentiation. Both Ikaros and Aiolos can participate in chromatin remodeling. Regulation of gene expression in B lymphocytes by Aiolos is complex as it appears to require the sequential formation of Ikaros homodimers, Ikaros/Aiolos heterodimers, and Aiolos homodimers. Several alternative transcripts encoding different isoforms have been described, as well as some non-protein coding variants. [provided by RefSeq, Apr 2012] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402225 | IKZF3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC405188 | IKZF3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC405192 | IKZF3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC430651 | IKZF3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402225 | Transient overexpression lysate of IKAROS family zinc finger 3 (Aiolos) (IKZF3), transcript variant 1 |
CNY 3,080.00 |
|
LY405188 | Transient overexpression lysate of IKAROS family zinc finger 3 (Aiolos) (IKZF3), transcript variant 2 |
CNY 4,840.00 |
|
LY405192 | Transient overexpression lysate of IKAROS family zinc finger 3 (Aiolos) (IKZF3), transcript variant 6 |
CNY 4,840.00 |
|
LY430651 | Transient overexpression lysate of IKAROS family zinc finger 3 (Aiolos) (IKZF3), transcript variant 6 |
CNY 3,080.00 |
|
PH307547 | IKZF3 MS Standard C13 and N15-labeled recombinant protein (NP_036613) |
CNY 19,520.00 |
|
PH319750 | IKZF3 MS Standard C13 and N15-labeled recombinant protein (NP_899054) |
CNY 14,250.00 |
|
TP307547 | Recombinant protein of human IKAROS family zinc finger 3 (Aiolos) (IKZF3), transcript variant 1, 20 µg |
CNY 2,900.00 |