GPR73A (PROKR1) (NM_138964) Human Recombinant Protein
CAT#: TP319745
Recombinant protein of human prokineticin receptor 1 (PROKR1), 20 µg
View other "GPR73A" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC219745 representing NM_138964
Red=Cloning site Green=Tags(s) METTMGFMDDNATNTSTSFLSVLNPHGAHATSFPFNFSYSDYDMPLDEDEDVTNSRTFFAAKIVIGMALV GIMLVCGIGNFIFIAALVRYKKLRNLTNLLIANLAISDFLVAIVCCPFEMDYYVVRQLSWEHGHVLCTSV NYLRTVSLYVSTNALLAIAIDRYLAIVHPLRPRMKCQTATGLIALVWTVSILIAIPSAYFTTETVLVIVK SQEKIFCGQIWPVDQQLYYKSYFLFIFGIEFVGPVVTMTLCYARISRELWFKAVPGFQTEQIRKRLRCRR KTVLVLMCILTAYVLCWAPFYGFTIVRDFFPTVFVKEKHYLTAFYIVECIAMSNSMINTLCFVTVKNDTV KYFKKIMLLHWKASYNGGKSSADLDLKTIGMPATEEVDCIRLK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 44.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_620414 |
Locus ID | 10887 |
UniProt ID | Q8TCW9 |
Refseq Size | 1182 |
Cytogenetics | 2p13.3 |
Refseq ORF | 1179 |
Synonyms | GPR73; GPR73a; PK-R1; PKR1; ZAQ |
Summary | This gene encodes a member of the G-protein-coupled receptor family. The encoded protein binds to prokineticins (1 and 2), leading to the activation of MAPK and STAT signaling pathways. Prokineticins are protein ligands involved in angiogenesis and inflammation. The encoded protein is expressed in peripheral tissues such as those comprising the circulatory system, lungs, reproductive system, endocrine system and the gastrointestinal system. The protein may be involved in signaling in human fetal ovary during initiation of primordial follicle formation. Sequence variants in this gene may be associated with recurrent miscarriage. [provided by RefSeq, Aug 2016] |
Protein Families | Druggable Genome, GPCR, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403372 | PROKR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403372 | Transient overexpression lysate of prokineticin receptor 1 (PROKR1) |
CNY 3,080.00 |
|
PH319745 | PROKR1 MS Standard C13 and N15-labeled recombinant protein (NP_620414) |
CNY 19,520.00 |