GCOM1 (POLR2M) (NM_015532) Human Recombinant Protein
CAT#: TP319621
Recombinant protein of human glutamate receptor, ionotropic, N-methyl D-aspartate-like 1A (GRINL1A), transcript variant 1, 20 µg
View other "GCOM1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC219621 representing NM_015532
Red=Cloning site Green=Tags(s) MCSLPRGFEPQAPEDLAQRSLVELREMLKRQERLLRNEKFICKLPDKGKKIFDSFAKLKAAIAECEEVRR KSELFNPVSLDCKLRQKAIAEVDVGTDKAQNSDPILDTSSLVPGCSSVDNIKSSQTSQNQGLGRPTLEGD EETSEVEYTVNKGPASSNRDRVPPSSEASEHHPRHRVSSQAEDTSSSFDNLFIDRLQRITIADQGEQQSE ENASTKNLTGLSSGTEKKPHYMEVLEMRAKNPVPQLRKFKTNVLPFRQNDSSSHCQKSGSPISSEERRRR DKQHLDDITAARLLPLHHMPTQLLSIEESLALQKQQKQNYEEMQAKLAAQKLAERLNIKMRSYNPEGESS GRYREVRDEDDDWSSDEF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 41.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | WB positive control (PMID: 26116512) |
Reference Data | |
RefSeq | NP_056347 |
Locus ID | 81488 |
UniProt ID | Q6EEV4 |
Refseq Size | 4139 |
Cytogenetics | 15q21.3 |
Refseq ORF | 1104 |
Synonyms | GCOM1; Gdown; Gdown1; GRINL1A |
Summary | This gene encodes a subunit of a specific form of RNA polymerase II termed Pol II(G). The encoded protein may act as a negative regulator of transcriptional activation by the Mediator complex. Alternative splicing results in multiple transcript variants. There is a pseudogene for this gene on chromosome 4. Readthrough transcription between this gene and the neighboring upstream gene MYZAP (myocardial zonula adherens protein) is represented with GeneID 145781. [provided by RefSeq, Oct 2013] |
Protein Families | Druggable Genome, Ion Channels: Other |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Primary Central Nervous System (CNS) Lymphoma B Cell Receptors Recognize CNS Proteins
,Montesinos-Rongen, M;Purschke, FG;Brunn, A;May, C;Nordhoff, E;Marcus, K;Deckert, M;,
J. Immunol.
,PubMed ID 26116512
[POLR2M]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414481 | POLR2M HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414481 | Transient overexpression lysate of glutamate receptor, ionotropic, N-methyl D-aspartate-like 1A (GRINL1A), transcript variant 1 |
CNY 3,080.00 |
|
PH319621 | GRINL1A MS Standard C13 and N15-labeled recombinant protein (NP_056347) |
CNY 19,520.00 |