EEF1G (NM_001404) Human Recombinant Protein
CAT#: TP319578
Recombinant protein of human eukaryotic translation elongation factor 1 gamma (EEF1G), 20 µg
View other "EEF1G" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
热销蛋白,享双倍赠礼
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC219578 representing NM_001404
Red=Cloning site Green=Tags(s) MAAGTLYTYPENWRAFKALIAAQYSGAQVRVLSAPPHFHFGQTNRTPEFLRKFPAGKVPAFEGDDGFCVF ESNAIAYYVSNEELRGSTPEAAAQVVQWVSFADSDIVPPASTWVFPTLGIMHHNKQATENAKEEVRRILG LLDAYLKTRTFLVGERVTLADITVVCTLLWLYKQVLEPSFRQAFPNTNRWFLTCINQPQFRAVLGEVKLC EKMAQFDAKKFAETQPKKDTPRKEKGSREEKQKPQAERKEEKKAAAPAPEEEMDECEQALAAEPKAKDPF AHLPKSTFVLDEFKRKYSNEDTLSVALPYFWEHFDKDGWSLWYSEYRFPEELTQTFMSCNLITGMFQRLD KLRKNAFASVILFGTNNSSSISGVWVFRGQELAFPLSPDWQVDYESYTWRKLDPGSEETQTLVREYFSWE GAFQHVGKAFNQGKIFK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 49.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | Biolayer interferometry (BLI) assay (PMID: 26624286) |
Reference Data | |
RefSeq | NP_001395 |
Locus ID | 1937 |
UniProt ID | P26641, Q53YD7 |
Refseq Size | 1429 |
Cytogenetics | 11q12.3 |
Refseq ORF | 1311 |
Synonyms | EF1G; GIG35 |
Summary | This gene encodes a subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This subunit contains an N-terminal glutathione transferase domain, which may be involved in regulating the assembly of multisubunit complexes containing this elongation factor and aminoacyl-tRNA synthetases. [provided by RefSeq, Jul 2008] |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Specific Interaction between eEF1A and HIV RT Is Critical for HIV-1 Reverse Transcription and a Potential Anti-HIV Target
,Li, D;Wei, T;Rawle, DJ;Qin, F;Wang, R;Soares, DC;Jin, H;Sivakumaran, H;Lin, MH;Spann, K;Abbott, CM;Harrich, D;,
PLoS Pathog.
,PubMed ID 26624286
[EEF1G]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419955 | EEF1G HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419955 | Transient overexpression lysate of eukaryotic translation elongation factor 1 gamma (EEF1G) |
CNY 3,080.00 |
|
PH319578 | EEF1G MS Standard C13 and N15-labeled recombinant protein (NP_001395) |
CNY 19,520.00 |