DEFB106A (NM_152251) Human Recombinant Protein
CAT#: TP319477
Recombinant protein of human defensin, beta 106A (DEFB106A), 20 µg
View other "DEFB106A" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC219477 protein sequence
Red=Cloning site Green=Tags(s) MRTFLFLFAVLFFLTPAKNAFFDEKCNKLKGTCKNNCGKNEELIALCQKSLKCCRTIQPCGSIID myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_689464 |
Locus ID | 245909 |
UniProt ID | Q8N104 |
Refseq Size | 325 |
Cytogenetics | 8p23.1 |
Refseq ORF | 195 |
Synonyms | BD-6; DEFB-6; DEFB106 |
Summary | Defensins form a family of antimicrobial and cytotoxic peptides made by neutrophils. Defensins are short, processed peptide molecules that are classified by structure into three groups: alpha-defensins, beta-defensins and theta-defensins. All beta-defensin genes are densely clustered in four to five syntenic chromosomal regions. Chromosome 8p23 contains at least two copies of the duplicated beta-defensin cluster. This duplication results in two identical copies of defensin, beta 106, DEFB106A and DEFB106B, in head-to-head orientation. This gene, DEFB106A, represents the more centromeric copy. [provided by RefSeq, Oct 2014] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407680 | DEFB106A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY407680 | Transient overexpression lysate of defensin, beta 106A (DEFB106A) |
CNY 3,080.00 |
|
PH319477 | DEFB106A MS Standard C13 and N15-labeled recombinant protein (NP_689464) |
CNY 19,520.00 |
其它DEFB106A产品