TMUB2 (NM_024107) Human Recombinant Protein
CAT#: TP319462
Recombinant protein of human transmembrane and ubiquitin-like domain containing 2 (TMUB2), transcript variant 1, 20 µg
View other "TMUB2" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC219462 protein sequence
Red=Cloning site Green=Tags(s) MELSDVTLIEGVGNEVMVVAGVVVLILALVLAWLSTYVADSGSNQLLGAIVSAGDTSVLHLGHVDHLVAG QGNPEPTELPHPSEGNDEKAEEAGEGRGDSTGEAGAGGGVEPSLEHLLDIQGLPKRQAGAGSSSPEAPLR SEDSTCLPPSPGLITVRLKFLNDTEELAVARPEDTVGALKSKYFPGQESQMKLIYQGRLLQDPARTLRSL NITDNCVIHCHRSPPGSAVPGPSASLAPSATEPPSLGVNVGSLMVPVFVVLLGVVWYFRINYRQFFTAPA TVSLVGVTVFFSFLVFGMYGR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 31.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_077012 |
Locus ID | 79089 |
UniProt ID | Q71RG4, Q71RG4-2 |
Refseq Size | 1942 |
Cytogenetics | 17q21.31 |
Refseq ORF | 903 |
Synonyms | FP2653 |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406167 | TMUB2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC411341 | TMUB2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC421354 | TMUB2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY406167 | Transient overexpression lysate of transmembrane and ubiquitin-like domain containing 2 (TMUB2), transcript variant 2 |
CNY 3,080.00 |
|
LY411341 | Transient overexpression lysate of transmembrane and ubiquitin-like domain containing 2 (TMUB2), transcript variant 1 |
CNY 3,080.00 |
|
LY421354 | Transient overexpression lysate of transmembrane and ubiquitin-like domain containing 2 (TMUB2), transcript variant 3 |
CNY 3,080.00 |
|
PH319462 | TMUB2 MS Standard C13 and N15-labeled recombinant protein (NP_077012) |
CNY 19,520.00 |