AGXT2 (NM_031900) Human Recombinant Protein
CAT#: TP319357
Recombinant protein of human alanine-glyoxylate aminotransferase 2 (AGXT2), nuclear gene encoding mitochondrial protein, 20 µg
View other "AGXT2" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC219357 representing NM_031900
Red=Cloning site Green=Tags(s) MTLIWRHLLRPLCLVTSAPRILEMHPFLSLGTSRTSVTKLSLHTKPRMPPCDFMPERYQSLGYNRVLEIH KEHLSPVVTAYFQKPLLLHQGHMEWLFDAEGSRYLDFFSGIVTVSVGHCHPKVNAVAQKQLGRLWHTSTV FFHPPMHEYAEKLAALLPEPLKVIFLVNSGSEANELAMLMARAHSNNIDIISFRGAYHGCSPYTLGLTNV GIYKMELPGGTGCQPTMCPDVFRGPWGGSHCRDSPVQTIRKCSCAPDCCQAKDQYIEQFKDTLSTSVAKS IAGFFAEPIQGVNGVVQYPKGFLKEAFELVRARGGVCIADEVQTGFGRLGSHFWGFQTHDVLPDIVTMAK GIGNGFPMAAVITTPEIAKSLAKCLQHFNTFGGNPMACAIGSAVLEVIKEENLQENSQEVGTYMLLKFAK LRDEFEIVGDVRGKGLMIGIEMVQDKISCRPLPREEVNQIHEDCKHMGLLVGRGSIFSQTFRIAPSMCIT KPEVDFAVEVFRSALTQHMERRAK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 52.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_114106 |
Locus ID | 64902 |
UniProt ID | Q9BYV1 |
Refseq Size | 2165 |
Cytogenetics | 5p13.2 |
Refseq ORF | 1542 |
Synonyms | AGT2; BAIBA; DAIBAT |
Summary | The protein encoded by this gene is a class III pyridoxal-phosphate-dependent mitochondrial aminotransferase. It catalyzes the conversion of glyoxylate to glycine using L-alanine as the amino donor. It is an important regulator of methylarginines and is involved in the control of blood pressure in kidney. Polymorphisms in this gene affect methylarginine and beta-aminoisobutyrate metabolism, and are associated with carotid atherosclerosis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2015] |
Protein Families | Druggable Genome |
Protein Pathways | Alanine, aspartate and glutamate metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410447 | AGXT2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY410447 | Transient overexpression lysate of alanine-glyoxylate aminotransferase 2 (AGXT2), nuclear gene encoding mitochondrial protein |
CNY 4,840.00 |
|
PH319357 | AGXT2 MS Standard C13 and N15-labeled recombinant protein (NP_114106) |
CNY 19,520.00 |
|
TP761230 | Purified recombinant protein of Human alanine--glyoxylate aminotransferase 2 (AGXT2), nuclear gene encoding mitochondrial protein, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2,040.00 |