United States
Germany
Japan
United Kingdom
China
FBXO44 (NM_183413) Human Recombinant Protein
CAT＃: TP319237
Recombinant protein of human F-box protein 44 (FBXO44), transcript variant 3, 20 µg
View other "FBXO44" proteins (11)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC219237 protein sequence
Red=Cloning site Green=Tags(s) MAVGNINELPENILLELFTHVPARQLLLNCRLVCSLWRDLIDLVTLWKRKCLREGFITEDWDQPVADWKI FYFLRSLHRNLLHNPCAEEGFEFWSLDVNGGDEWKVEDLSRDQRKEFPNDQVRSQARLRVQVPAVRSAPV VRARASGDLPARPGDHPAEERCQVEGGLPHILQLPARRPLHLVSARRRGHSLLGRLVRPEGHQQQHHHRA PAALTPPEPPSAEP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 25.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_904320 |
| Locus ID | 93611 |
| UniProt ID | Q9H4M3 |
| Refseq Size | 2823 |
| Cytogenetics | 1p36.22 |
| Refseq ORF | 672 |
| Synonyms | FBG3; FBX6A; FBX30; Fbx44; Fbxo6a |
| Summary | This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class. It is also a member of the NFB42 (neural F Box 42 kDa) family, similar to F-box only protein 2 and F-box only protein 6. Several alternatively spliced transcript variants encoding two distinct isoforms have been found for this gene. [provided by RefSeq, Feb 2015] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403232 | FBXO44 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC405197 | FBXO44 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC405198 | FBXO44 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC423077 | FBXO44 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC430665 | FBXO44 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403232 | Transient overexpression lysate of F-box protein 44 (FBXO44), transcript variant 1 |
CNY 3,080.00 |
|
| LY405197 | Transient overexpression lysate of F-box protein 44 (FBXO44), transcript variant 2 |
CNY 3,080.00 |
|
| LY405198 | Transient overexpression lysate of F-box protein 44 (FBXO44), transcript variant 3 |
CNY 3,080.00 |
|
| LY423077 | Transient overexpression lysate of F-box protein 44 (FBXO44), transcript variant 4 |
CNY 3,080.00 |
|
| PH319237 | FBXO44 MS Standard C13 and N15-labeled recombinant protein (NP_904320) |
CNY 19,520.00 |
|
| TP760409 | Purified recombinant protein of Human F-box protein 44 (FBXO44), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2,040.00 |
