BCAT1 (NM_005504) Human Recombinant Protein
CAT#: TP319229
Recombinant protein of human branched chain aminotransferase 1, cytosolic (BCAT1), 20 µg
View other "BCAT1" proteins (12)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CN¥ 2,900.00
CN¥ 6,650.00
CN¥ 1,999.00
CN¥ 2,700.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC219229 representing NM_005504
Red=Cloning site Green=Tags(s) MKDCSNGCSAECTGEGGSKEVVGTFKAKDLIVTPATILKEKPDPNNLVFGTVFTDHMLTVEWSSEFGWEK PHIKPLQNLSLHPGSSALHYAVELFEGLKAFRGVDNKIRLFQPNLNMDRMYRSAVRATLPVFDKEELLEC IQQLVKLDQEWVPYSTSASLYIRPTFIGTEPSLGVKKPTKALLFVLLSPVGPYFSSGTFNPVSLWANPKY VRAWKGGTGDCKMGGNYGSSLFAQCEAVDNGCQQVLWLYGEDHQITEVGTMNLFLYWINEDGEEELATPP LDGIILPGVTRRCILDLAHQWGEFKVSERYLTMDDLTTALEGNRVREMFGSGTACVVCPVSDILYKGETI HIPTMENGPKLASRILSKLTDIQYGREESDWTIVLS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 42.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_005495 |
Locus ID | 586 |
UniProt ID | P54687 |
Refseq Size | 8191 |
Cytogenetics | 12p12.1 |
Refseq ORF | 1158 |
Synonyms | BCATC; BCT1; ECA39; MECA39; PNAS121; PP18 |
Summary | This gene encodes the cytosolic form of the enzyme branched-chain amino acid transaminase. This enzyme catalyzes the reversible transamination of branched-chain alpha-keto acids to branched-chain L-amino acids essential for cell growth. Two different clinical disorders have been attributed to a defect of branched-chain amino acid transamination: hypervalinemia and hyperleucine-isoleucinemia. As there is also a gene encoding a mitochondrial form of this enzyme, mutations in either gene may contribute to these disorders. Alternatively spliced transcript variants have been described. [provided by RefSeq, May 2010] |
Protein Families | Druggable Genome |
Protein Pathways | Metabolic pathways, Pantothenate and CoA biosynthesis, Valine, leucine and isoleucine biosynthesis, Valine, leucine and isoleucine degradation |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401683 | BCAT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC432891 | BCAT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC432924 | BCAT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC432972 | BCAT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC432999 | BCAT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY401683 | Transient overexpression lysate of branched chain aminotransferase 1, cytosolic (BCAT1) |
CN¥ 3,080.00 |
|
LY432891 | Transient overexpression lysate of branched chain amino-acid transaminase 1, cytosolic (BCAT1), transcript variant 3 |
CN¥ 3,080.00 |
|
LY432924 | Transient overexpression lysate of branched chain amino-acid transaminase 1, cytosolic (BCAT1), transcript variant 2 |
CN¥ 3,080.00 |
|
LY432972 | Transient overexpression lysate of branched chain amino-acid transaminase 1, cytosolic (BCAT1), transcript variant 5 |
CN¥ 3,080.00 |
|
LY432999 | Transient overexpression lysate of branched chain amino-acid transaminase 1, cytosolic (BCAT1), transcript variant 4 |
CN¥ 3,080.00 |
|
PH319229 | BCAT1 MS Standard C13 and N15-labeled recombinant protein (NP_005495) |
CN¥ 19,520.00 |
|
TP760653 | Purified recombinant protein of Human branched chain amino-acid transaminase 1, cytosolic (BCAT1), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CN¥ 2,040.00 |