Iduronate 2 sulfatase (IDS) (NM_000202) Human Recombinant Protein
CAT#: TP319187
Recombinant protein of human iduronate 2-sulfatase (IDS), transcript variant 1, 20 µg
View other "Iduronate 2 sulfatase" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC219187 representing NM_000202
Red=Cloning site Green=Tags(s) MPPPRTGRGLLWLGLVLSSVCVALGSETQANSTTDALNVLLIIVDDLRPSLGCYGDKLVRSPNIDQLASH SLLFQNAFAQQAVCAPSRVSFLTGRRPDTTRLYDFNSYWRVHAGNFSTIPQYFKENGYVTMSVGKVFHPG ISSNHTDDSPYSWSFPPYHPSSEKYENTKTCRGPDGELHANLLCPVDVLDVPEGTLPDKQSTEQAIQLLE KMKTSASPFFLAVGYHKPHIPFRYPKEFQKLYPLENITLAPDPEVPDGLPPVAYNPWMDIRQREDVQALN ISVPYGPIPVDFQRKIRQSYFASVSYLDTQVGRLLSALDDLQLANSTIIAFTSDHGWALGEHGEWAKYSN FDVATHVPLIFYVPGRTASLPEAGEKLFPYLDPFDSASQLMEPGRQSMDLVELVSLFPTLAGLAGLQVPP RCPVPSFHVELCREGKNLLKHFRFRDLEEDPYLPGNPRELIAYSQYPRPSDIPQWNSDKPSLKDIKIMGY SIRTIDYRYTVWVGFNPDEFLANFSDIHAGELYFVDSDPLQDHNMYNDSQGGDLFQLLMP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 59.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_000193 |
Locus ID | 3423 |
UniProt ID | P22304 |
Refseq Size | 2504 |
Cytogenetics | Xq28 |
Refseq ORF | 1650 |
Synonyms | ID2S; MPS2; SIDS |
Summary | This gene encodes a member of the sulfatase family of proteins. The encoded preproprotein is proteolytically processed to generate two polypeptide chains. This enzyme is involved in the lysosomal degradation of heparan sulfate and dermatan sulfate. Mutations in this gene are associated with the X-linked lysosomal storage disease mucopolysaccharidosis type II, also known as Hunter syndrome. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed. [provided by RefSeq, Jan 2016] |
Protein Families | Druggable Genome |
Protein Pathways | Glycosaminoglycan degradation, Lysosome, Metabolic pathways |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416853 | IDS HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC424863 | IDS HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC433123 | IDS HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416853 | Transient overexpression lysate of iduronate 2-sulfatase (IDS), transcript variant 2 |
CNY 3,080.00 |
|
LY424863 | Transient overexpression lysate of iduronate 2-sulfatase (IDS), transcript variant 1 |
CNY 4,840.00 |
|
LY433123 | Transient overexpression lysate of iduronate 2-sulfatase (IDS), transcript variant 3 |
CNY 3,080.00 |
|
PH319187 | IDS MS Standard C13 and N15-labeled recombinant protein (NP_000193) |
CNY 19,520.00 |
其它Iduronate 2 sulfatase产品