PPM1L (NM_139245) Human Recombinant Protein
CAT#: TP318909
Recombinant protein of human protein phosphatase 1 (formerly 2C)-like (PPM1L), 20 µg
View other "PPM1L" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC218909 representing NM_139245
Red=Cloning site Green=Tags(s) MIEDTMTLLSLLGRIMRYFLLRPETLFLLCISLALWSYFFHTDEVKTIVKSSRDAVKMVKGKVAEIMQND RLGGLDVLEAEFSKTWEFKNHNVAVYSIQGRRDHMEDRFEVLTDLANKTHPSIFGIFDGHGGETAAEYVK SRLPEALKQHLQDYEKDKENSVLSYQTILEQQILSIDREMLEKLTVSYDEAGTTCLIALLSDKDLTVANV GDSRGVLCDKDGNAIPLSHDHKPYQLKERKRIKRAGGFISFNGSWRVQGILAMSRSLGDYPLKNLNVVIP DPDILTFDLDKLQPEFMILASDGLWDAFSNEEAVRFIKERLDEPHFGAKSIVLQSFYRGCPDNITVMVVK FRNSSKTEEQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 40.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_640338 |
Locus ID | 151742 |
UniProt ID | Q5SGD2 |
Refseq Size | 3056 |
Cytogenetics | 3q25.33-q26.1 |
Refseq ORF | 1080 |
Synonyms | PP2C-epsilon; PP2CE; PPM1-LIKE |
Summary | The protein encoded by this gene is a magnesium or manganese-requiring phosphatase that is involved in several signaling pathways. The encoded protein downregulates apoptosis signal-regulating kinase 1, a protein that initiates a signaling cascade that leads to apoptosis when cells are subjected to cytotoxic stresses. This protein also is an endoplasmic reticulum transmembrane protein that helps regulate ceramide transport from the endoplasmic reticulum to the Golgi apparatus. Finally, this gene may be involved in adiposity since it is upregulated in adipose tissues. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2015] |
Protein Families | Druggable Genome, Phosphatase |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408320 | PPM1L HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY408320 | Transient overexpression lysate of protein phosphatase 1 (formerly 2C)-like (PPM1L) |
CNY 3,080.00 |
|
PH318909 | PPM1L MS Standard C13 and N15-labeled recombinant protein (NP_640338) |
CNY 19,520.00 |