SHOX (NM_000451) Human Recombinant Protein
CAT#: TP318605
Recombinant protein of human short stature homeobox (SHOX), transcript variant 1, 20 µg
View other "SHOX" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC218605 representing NM_000451
Red=Cloning site Green=Tags(s) MEELTAFVSKSFDQKSKDGNGGGGGGGGKKDSITYREVLESGLARSRELGTSDSSLQDITEGGGHCPVHL FKDHVDNDKEKLKEFGTARVAEGIYECKEKREDVKSEDEDGQTKLKQRRSRTNFTLEQLNELERLFDETH YPDAFMREELSQRLGLSEARVQVWFQNRRAKCRKQENQMHKGVILGTANHLDACRVAPYVNMGALRMPFQ QVQAQLQLEGVAHAHPHLHPHLAAHAPYLMFPPPPFGLPIASLAESASAAAVVAAAAKSNSKNSSIADLR LKARKHAEALGL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 32.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_000442 |
Locus ID | 6473 |
UniProt ID | O15266, A0A024R385 |
Refseq Size | 4559 |
Cytogenetics | X;Y |
Refseq ORF | 876 |
Synonyms | GCFX; PHOG; SHOXY; SS |
Summary | This gene belongs to the paired homeobox family and is located in the pseudoautosomal region 1 (PAR1) of X and Y chromosomes. Defects in this gene are associated with idiopathic growth retardation and in the short stature phenotype of Turner syndrome patients. This gene is highly conserved across species from mammals to fish to flies. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424707 | SHOX HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY424707 | Transient overexpression lysate of short stature homeobox (SHOX), transcript variant 1 |
CNY 3,080.00 |
|
PH318605 | SHOX MS Standard C13 and N15-labeled recombinant protein (NP_000442) |
CNY 14,250.00 |