C14orf151 (INF2) (NM_032714) Human Recombinant Protein
CAT#: TP318469
Recombinant protein of human chromosome 14 open reading frame 151 (C14orf151), 20 µg
View other "C14orf151" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC218469 protein sequence
Red=Cloning site Green=Tags(s) MSVKEGAQRKWAALKEKLGPQDSDPTEANLESADPELCIRLLQMPSVVNYSGLRKRLEGSDGGWMVQFLE QSGLDLLLEALARLSGRGVARISDALLQLTCVSCVRAVMNSRQGIEYILSNQGYVRQLSQALDTSNVMVK KQVFELLAALCIYSPEGHVLTLDALDHYKTVCSQQYRFSIVMNELSGSDNVPYVVTLLSVINAVILGPED LRARTQLRNEFIGLQLLDVLARLR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 25.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_116103 |
Locus ID | 64423 |
UniProt ID | Q27J81 |
Refseq Size | 1719 |
Cytogenetics | 14q32.33 |
Refseq ORF | 702 |
Synonyms | C14orf151; C14orf173; CMTDIE; FSGS5; pp9484 |
Summary | This gene represents a member of the formin family of proteins. It is considered a diaphanous formin due to the presence of a diaphanous inhibitory domain located at the N-terminus of the encoded protein. Studies of a similar mouse protein indicate that the protein encoded by this locus may function in polymerization and depolymerization of actin filaments. Mutations at this locus have been associated with focal segmental glomerulosclerosis 5.[provided by RefSeq, Aug 2010] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409977 | INF2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC411560 | INF2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY409977 | Transient overexpression lysate of inverted formin, FH2 and WH2 domain containing (INF2), transcript variant 3 |
CNY 3,080.00 |
|
LY411560 | Transient overexpression lysate of inverted formin, FH2 and WH2 domain containing (INF2), transcript variant 1 |
CNY 4,840.00 |
|
PH316716 | INF2 MS Standard C13 and N15-labeled recombinant protein (NP_071934) |
CNY 19,520.00 |
|
PH318469 | INF2 MS Standard C13 and N15-labeled recombinant protein (NP_116103) |
CNY 19,520.00 |
|
TP316716 | Recombinant protein of human inverted formin, FH2 and WH2 domain containing (INF2), transcript variant 1, 20 µg |
CNY 2,900.00 |
其它C14orf151产品