C14orf130 (UBR7) (NM_175748) Human Recombinant Protein
CAT#: TP318298
Recombinant protein of human ubiquitin protein ligase E3 component n-recognin 7 (putative) (UBR7), transcript variant 2, 20 µg
View other "C14orf130" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC218298 representing NM_175748
Red=Cloning site Green=Tags(s) MAGAEGAAGRQSELEPVVSLVDVLEEDEELENEACAVLGGSDSEKCSYSQGSVKRQALYACSTCTPEGEE PAGICLACSYECHGSHKLFELYTKRNFRCDCGNSKFKNLECKLLPDKAKVNSGNKYNDNFFGLYCICKRP YPDPEDEIPDEMIQCVVCEDWFHGRHLGAIPPESGDFQEMVCQACMKRCSFLWAYAAQLAVTKISTEDDG LVRNIDGIGDQEVIKPENGEHQDSTLKEDVPEQGKDDVREVKVEQNSEPCAGSSSESDLQTVFKNESLNA ESKSGCKLQELKAKQLIKKDTATYWPLNWRSKLCTCQDCMKMYGDLDVLFLTDEYDTVLAYENKGKIAQA TDRSDPLMDTLSSMNRVQQVELICEYNDLKTELKDYLKRFADEGTVVKREDIQQFFEEFQSKKRRRVDGM QYYCS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 47.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_786924 |
Locus ID | 55148 |
UniProt ID | Q8N806 |
Refseq Size | 1576 |
Cytogenetics | 14q32.12 |
Refseq ORF | 1275 |
Synonyms | C14orf130; LICAS |
Summary | This gene encodes a UBR box-containing protein that belongs to the E3 ubiquitin ligase family. The protein also contains a plant homeodomain (PHD) in the C-terminus. In mammals, the encoded protein recognizes N-degrons, the destabilizing N-terminal residues of short-lived proteins, which results in ubiquitinylation, and proteolysis via the proteasome. [provided by RefSeq, Jul 2016] |
Protein Families | Druggable Genome |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Manumycin Polyketides Act as Molecular Glues Between UBR7 and P53 to Impair Breast Cancer Pathogenicity
,Isobe, Y;Okumura, M;White, R;McGregor, LM;,
bioRxiv
[UBR7]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403580 | UBR7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC420256 | UBR7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403580 | Transient overexpression lysate of ubiquitin protein ligase E3 component n-recognin 7 (putative) (UBR7), transcript variant 2 |
CNY 3,080.00 |
|
LY420256 | Transient overexpression lysate of ubiquitin protein ligase E3 component n-recognin 7 (putative) (UBR7), transcript variant 3 |
CNY 3,080.00 |
|
PH318298 | UBR7 MS Standard C13 and N15-labeled recombinant protein (NP_786924) |
CNY 19,520.00 |
其它C14orf130产品