C5ORF44 (TRAPPC13) (NM_001093756) Human Recombinant Protein
CAT#: TP318288
Recombinant protein of human chromosome 5 open reading frame 44 (C5orf44), transcript variant 3, 20 µg
View other "C5ORF44" proteins (8)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC218288 representing NM_001093756
Red=Cloning site Green=Tags(s) MEVNPPKQEHLLALKVMRLTKPTLFTNIPVTCEEKDLPGDLFNQLMRDDPSTVNGAEVLMLGEMLTLPQN FGNIFLGETFSSYISVHNDSNQVVKDILVKADLQTSSQRLNLSASNAAVAELKPDCCIDDVIHHEVKEIG THILVCAVSYTTQAGEKMYFRKFFKFQVLKPLDVKTKFYNAETDEVFLEAQIQNMTTSPMFMEKVSLEPS IMYNVTELNSVSQAGECVSTFGSRAYLQPMDTRQYLYCLKPKNEFAEKAGIIKGVTVIGKLDIVWKTNLG ERGRLQTSQLQRMAPGYGDVRLSLEAIPDTVNLEEPFHITCKITNCSERTMDLVLEMCNTNSIHWCGISG RQLGKLHPSSSLCLALTLLSSVQGLQSISGLRLTDTFLKRTYEYDDIAQVCVVSSAIKVES myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 45.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001087225 |
Locus ID | 80006 |
UniProt ID | A5PLN9 |
Refseq Size | 3099 |
Cytogenetics | 5q12.3 |
Refseq ORF | 1233 |
Synonyms | C5orf44; SHLD3 |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410973 | TRAPPC13 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC420688 | TRAPPC13 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC420689 | TRAPPC13 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY410973 | Transient overexpression lysate of chromosome 5 open reading frame 44 (C5orf44), transcript variant 2 |
CNY 4,840.00 |
|
LY420688 | Transient overexpression lysate of chromosome 5 open reading frame 44 (C5orf44), transcript variant 1 |
CNY 4,840.00 |
|
LY420689 | Transient overexpression lysate of chromosome 5 open reading frame 44 (C5orf44), transcript variant 3 |
CNY 3,080.00 |
|
PH318288 | C5orf44 MS Standard C13 and N15-labeled recombinant protein (NP_001087225) |
CNY 19,520.00 |
|
TP761014 | Purified recombinant protein of Human chromosome 5 open reading frame 44 (C5orf44), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.coli, 50ug |
CNY 2,040.00 |
其它C5ORF44产品