FAM89B (NM_001098785) Human Recombinant Protein
CAT#: TP318225
Recombinant protein of human family with sequence similarity 89, member B (FAM89B), transcript variant 1, 20 µg
View other "FAM89B" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC218225 representing NM_001098785
Red=Cloning site Green=Tags(s) MNGLPSAEAPGGAGCALAGLPPLPRGLSGLLNASGGSWRELERVYSQRSRIHDELSRAARAPDGPRHAAG AANAGPAAGPRRPVNLDSALAALRKEMVGLRQLDMSLLCQLWGLYESIQDYKHLCQDLSFCQDLSSSLHS DSSYPPDAGLSDDEEPPDASLPPDPPPLTVPQTHNARDQWLQDAFHISL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 20 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001092255 |
Locus ID | 23625 |
UniProt ID | Q8N5H3 |
Refseq Size | 1467 |
Cytogenetics | 11q13.1 |
Refseq ORF | 567 |
Synonyms | LRAP25; MTVR; MTVR1 |
Summary | Negatively regulates TGF-beta-induced signaling; in cooperation with SKI prevents the translocation of SMAD2 from the nucleus to the cytoplasm in response to TGF-beta. Acts as an adapter that mediates the specific recognition of LIMK1 by CDC42BPA and CDC42BPB in the lamellipodia. LRAP25-mediated CDC42BPA/CDC42BPB targeting to LIMK1 and the lamellipodium results in LIMK1 activation and the subsequent phosphorylation of CFL1 which is important for lamellipodial F-actin regulation.[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407290 | FAM89B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC420673 | FAM89B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC420674 | FAM89B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY407290 | Transient overexpression lysate of family with sequence similarity 89, member B (FAM89B), transcript variant 2 |
CNY 3,080.00 |
|
LY420673 | Transient overexpression lysate of family with sequence similarity 89, member B (FAM89B), transcript variant 3 |
CNY 3,080.00 |
|
LY420674 | Transient overexpression lysate of family with sequence similarity 89, member B (FAM89B), transcript variant 1 |
CNY 3,080.00 |
|
PH318225 | FAM89B MS Standard C13 and N15-labeled recombinant protein (NP_001092255) |
CNY 19,520.00 |