HOMER2 (NM_199332) Human Recombinant Protein
CAT#: TP318155
Purified recombinant protein of Homo sapiens homer homolog 2 (Drosophila) (HOMER2), transcript variant 4, 20 µg
View other "HOMER2" proteins (15)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CN¥ 2,900.00
CN¥ 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC218155 representing NM_199332
Red=Cloning site Green=Tags(s) MGEQPIFTTRAHVFQIDPNTKKNWMPASKQAVTVSYFYDVTRNSYRIISVDGAKVIINSTITPNMTFTKT SQKFGQWADSRANTVFGLGFSSEQQLTKFAEKFQEVKEAAKIAKDKTQEKIETSSNHSQESGRETPSSTQ ASSVNGTDDEKASHAGPANTHLKSENDKLKIALTQSAANVKNEINREKEKNTQLKRRIEELEAELREKET ELKDLRKQSEIIPQLMSECEYVSEKLEAAERDNQNLEDKVRSLKTDIEESKYRQRHLKVELKSFLEVLDG KIDDLHDFRRGLSKLGTDN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 33.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_955364 |
Locus ID | 9455 |
UniProt ID | Q9NSB8 |
Refseq Size | 1840 |
Cytogenetics | 15q25.2 |
Refseq ORF | 897 |
Synonyms | ACPD; CPD; HOMER-2; HOMER2A; HOMER2B; Vesl-2 |
Summary | This gene encodes a member of the homer family of dendritic proteins. Members of this family regulate group 1 metabotrophic glutamate receptor function. The encoded protein is a postsynaptic density scaffolding protein. Alternative splicing results in multiple transcript variants. Two related pseudogenes have been identified on chromosome 14. [provided by RefSeq, Jun 2011] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401516 | HOMER2 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC404625 | HOMER2 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC404626 | HOMER2 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC404627 | HOMER2 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY401516 | Transient overexpression lysate of homer homolog 2 (Drosophila) (HOMER2), transcript variant 1 |
CN¥ 3,080.00 |
|
LY404625 | Transient overexpression lysate of homer homolog 2 (Drosophila) (HOMER2), transcript variant 2 |
CN¥ 3,080.00 |
|
LY404626 | Transient overexpression lysate of homer homolog 2 (Drosophila) (HOMER2), transcript variant 3 |
CN¥ 3,080.00 |
|
LY404627 | Transient overexpression lysate of homer homolog 2 (Drosophila) (HOMER2), transcript variant 4 |
CN¥ 3,080.00 |
|
PH304165 | HOMER2 MS Standard C13 and N15-labeled recombinant protein (NP_004830) |
CN¥ 19,520.00 |
|
PH314311 | HOMER2 MS Standard C13 and N15-labeled recombinant protein (NP_955363) |
CN¥ 14,250.00 |
|
PH318155 | HOMER2 MS Standard C13 and N15-labeled recombinant protein (NP_955364) |
CN¥ 14,250.00 |
|
PH323154 | HOMER2 MS Standard C13 and N15-labeled recombinant protein (NP_955362) |
CN¥ 14,250.00 |
|
TP304165 | Recombinant protein of human homer homolog 2 (Drosophila) (HOMER2), transcript variant 1, 20 µg |
CN¥ 2,900.00 |
|
TP314311 | Purified recombinant protein of Homo sapiens homer homolog 2 (Drosophila) (HOMER2), transcript variant 3, 20 µg |
CN¥ 2,900.00 |
|
TP323154 | Purified recombinant protein of Homo sapiens homer homolog 2 (Drosophila) (HOMER2), transcript variant 2, 20 µg |
CN¥ 2,900.00 |