ODAPH (NM_178497) Human Recombinant Protein
CAT#: TP318037
Recombinant protein of human chromosome 4 open reading frame 26 (C4orf26), 20 µg
View other "ODAPH" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CN¥ 2,900.00
CN¥ 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC218037 protein sequence
Red=Cloning site Green=Tags(s) MARRHCFSYWLLVCWLVVTVAEGQEEVFTPPGDSQNNADATDCQIFTLTPPPAPRSPVTRAQPITKTPRC PFHFFPRRPRIHFRFPNRPFVPSRCNHRFPFQPFYWPHRYLTYRYFPRRRLQRGSSSEES myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 15.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_848592 |
Locus ID | 152816 |
UniProt ID | Q17RF5 |
Refseq Size | 1882 |
Cytogenetics | 4q21.1 |
Refseq ORF | 390 |
Synonyms | AI2A4; C4orf26 |
Summary | Dental enamel forms the outer cap of teeth and is the hardest substance found in vertebrates. This gene is thought to encode an extracellular matrix acidic phosphoprotein that has a function in enamel mineralization during amelogenesis. Mutations in this gene are associated with recessive hypomineralized amelogenesis imperfecta. [provided by RefSeq, Oct 2012] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405890 | C4orf26 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY405890 | Transient overexpression lysate of chromosome 4 open reading frame 26 (C4orf26) |
CN¥ 3,080.00 |
|
PH318037 | C4orf26 MS Standard C13 and N15-labeled recombinant protein (NP_848592) |
CN¥ 19,520.00 |