XRCC4 (NM_022550) Human Recombinant Protein
CAT#: TP318029
Recombinant protein of human X-ray repair complementing defective repair in Chinese hamster cells 4 (XRCC4), transcript variant 3, 20 µg
View other "XRCC4" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC218029 representing NM_022550
Red=Cloning site Green=Tags(s) MERKISRIHLVSEPSITHFLQVSWEKTLESGFVITLTDGHSAWTGTVSESEISQEADDMAMEKGKYVGEL RKALLSGAGPADVYTFNFSKESCYFFFEKNLKDVSFRLGSFNLEKVENPAEVIRELICYCLDTIAENQAK NEHLQKENERLLRDWNDVQGRFEKCVSAKEALETDLYKRFILVLNEKKTKIRSLHNKLLNAAQEREKDIK QEGETAICSEMTADRDPVYDESTDEESENQTDLSGLASAAVSKDDSIISSLDVTDIAPSRKRRQRMQRNL GTEPKMAPQENQLQEKENSRPDSSLPETSKKEHISAENMSLETLRNSSPEDLFDEI myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 37.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_072044 |
Locus ID | 7518 |
UniProt ID | Q13426 |
Refseq Size | 1707 |
Cytogenetics | 5q14.2 |
Refseq ORF | 1008 |
Synonyms | SSMED |
Summary | The protein encoded by this gene functions together with DNA ligase IV and the DNA-dependent protein kinase in the repair of DNA double-strand breaks. This protein plays a role in both non-homologous end joining and the completion of V(D)J recombination. Mutations in this gene can cause short stature, microcephaly, and endocrine dysfunction (SSMED). Alternate transcript variants such as NM_022406 are unlikely to be expressed in some individuals due to a polymorphism (rs1805377) in the last splice acceptor site. [provided by RefSeq, Oct 2019] |
Protein Families | Druggable Genome |
Protein Pathways | Non-homologous end-joining |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Quantification of XRCC and DNA-PK proteins in cancer cell lines and human tumors by LC-MS/MS
,Myers, MV;Maxwell, SE;Wang, X;,
Bioanalysis
,PubMed ID 24785829
[XRCC4]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402930 | XRCC4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC418718 | XRCC4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402930 | Transient overexpression lysate of X-ray repair complementing defective repair in Chinese hamster cells 4 (XRCC4), transcript variant 3 |
CNY 3,080.00 |
|
LY418718 | Transient overexpression lysate of X-ray repair complementing defective repair in Chinese hamster cells 4 (XRCC4), transcript variant 1 |
CNY 3,080.00 |
|
PH312684 | XRCC4 MS Standard C13 and N15-labeled recombinant protein (NP_003392) |
CNY 19,520.00 |
|
PH318029 | XRCC4 MS Standard C13 and N15-labeled recombinant protein (NP_072044) |
CNY 19,520.00 |
|
TP312684 | Recombinant protein of human X-ray repair complementing defective repair in Chinese hamster cells 4 (XRCC4), transcript variant 1, 20 µg |
CNY 2,900.00 |