IRF7 (NM_001572) Human Recombinant Protein
CAT#: TP317934
Recombinant protein of human interferon regulatory factor 7 (IRF7), transcript variant a, 20 µg
View other "IRF7" proteins (6)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC217934 representing NM_001572
Red=Cloning site Green=Tags(s) MALAPERAAPRVLFGEWLLGEISSGCYEGLQWLDEARTCFRVPWKHFARKDLSEADARIFKAWAVARGRW PPSSRGGGPPPEAETAERAGWKTNFRCALRSTRRFVMLRDNSGDPADPHKVYALSRELCWREGPGTDQTE AEAPAAVPPPQGGPPGPFLAHTHAGLQAPGPLPAPAGDKGDLLLQAVQQSCLADHLLTASWGADPVPTKA PGEGQEGLPLTGACAGGPGLPAGELYGWAVETTPSPGPQPAALTTGEAAAPESPHQAEPYLSPSPSACTA VQEPSPGALDVTIMYKGRTVLQKVVGHPSCTFLYGPPDPAVRATDPQQVAFPSPAELPDQKQLRYTEELL RHVAPGLHLELRGPQLWARRMGKCKVYWEVGGPPGSASPSTPACLLPRNCDTPIFDFRVFFQELVEFRAR QRRGSPRYTIYLGFGQDLSAGRPKEKSLVLVKLEPWLCRVHLEGTQREGVSSLDSSSLSLCLSSANSLYD DIECFLMELEQPASGP SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Predicted MW | 54.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001563 |
Locus ID | 3665 |
UniProt ID | Q92985 |
Refseq Size | 1890 |
Cytogenetics | 11p15.5 |
Refseq ORF | 1518 |
Synonyms | IMD39; IRF-7; IRF-7H; IRF7A; IRF7B; IRF7C; IRF7H |
Summary | IRF7 encodes interferon regulatory factor 7, a member of the interferon regulatory transcription factor (IRF) family. IRF7 has been shown to play a role in the transcriptional activation of virus-inducible cellular genes, including interferon beta chain genes. Inducible expression of IRF7 is largely restricted to lymphoid tissue. Multiple IRF7 transcript variants have been identified, although the functional consequences of these have not yet been established. [provided by RefSeq, Jul 2008] |
Protein Families | Transcription Factors |
Protein Pathways | Cytosolic DNA-sensing pathway, RIG-I-like receptor signaling pathway, Toll-like receptor signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400601 | IRF7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC418288 | IRF7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY400601 | Transient overexpression lysate of interferon regulatory factor 7 (IRF7), transcript variant a |
CNY 4,840.00 |
|
LY418288 | Transient overexpression lysate of interferon regulatory factor 7 (IRF7), transcript variant d |
CNY 4,840.00 |
|
PH317934 | IRF7 MS Standard C13 and N15-labeled recombinant protein (NP_001563) |
CNY 19,520.00 |
|
TP761223 | Purified recombinant protein of Human interferon regulatory factor 7 (IRF7), transcript variant a, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2,040.00 |