CACNB1 (NM_199247) Human Recombinant Protein
CAT#: TP317910
Recombinant protein of human calcium channel, voltage-dependent, beta 1 subunit (CACNB1), transcript variant 2, 20 µg
View other "CACNB1" proteins (9)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC217910 representing NM_199247
Red=Cloning site Green=Tags(s) MVQKTSMSRGPYPPSQEIPMEVFDPSPQGKYSKRKGRFKRSDGSTSSDTTSNSFVRQGSAESYTSRPSDS DVSLEEDREALRKEAERQALAQLEKAKTKPVAFAVRTNVGYNPSPGDEVPVQGVAITFEPKDFLHIKEKY NNDWWIGRLVKEGCEVGFIPSPVKLDSLRLLQEQKLRQNRLGSSKSGDNSSSSLGDVVTGTRRPTPPASG NEMTNLAFELDPLELEEEEAELGEQSGSAKTSVSSVTTPPPHGKRIPFFKKTEHVPPYDVVPSMRPIILV GPSLKGYEVTDMMQKALFDFLKHRFDGRISITRVTADISLAKRSVLNNPSKHIIIERSNTRSSLAEVQSE IERIFELARTLQLVALDADTINHPAQLSKTSLAPIIVYIKITSPKVLQRLIKSRGKSQSKHLNVQIAASE KLAQCPPEMFDIILDENQLEDACEHLAEYLEAYWKATHPPSSTPPNPLLNRTMATAALAASPAPVSNLQV QVLTSLRRNLGFWGGLESSQRGSVVPQEQEHAM myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 57.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_954855 |
Locus ID | 782 |
UniProt ID | Q02641, Q02641-2 |
Refseq Size | 1847 |
Cytogenetics | 17q12 |
Refseq ORF | 1569 |
Synonyms | CAB1; CACNLB1; CCHLB1 |
Summary | The protein encoded by this gene belongs to the calcium channel beta subunit family. It plays an important role in the calcium channel by modulating G protein inhibition, increasing peak calcium current, controlling the alpha-1 subunit membrane targeting and shifting the voltage dependence of activation and inactivation. Alternative splicing occurs at this locus and three transcript variants encoding three distinct isoforms have been identified. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Ion Channels: Other |
Protein Pathways | Arrhythmogenic right ventricular cardiomyopathy (ARVC), Cardiac muscle contraction, Dilated cardiomyopathy, Hypertrophic cardiomyopathy (HCM), MAPK signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403703 | CACNB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC404593 | CACNB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC424552 | CACNB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403703 | Transient overexpression lysate of calcium channel, voltage-dependent, beta 1 subunit (CACNB1), transcript variant 2 |
CNY 4,840.00 |
|
LY404593 | Transient overexpression lysate of calcium channel, voltage-dependent, beta 1 subunit (CACNB1), transcript variant 3 |
CNY 4,840.00 |
|
LY424552 | Transient overexpression lysate of calcium channel, voltage-dependent, beta 1 subunit (CACNB1), transcript variant 1 |
CNY 3,080.00 |
|
PH307230 | CACNB1 MS Standard C13 and N15-labeled recombinant protein (NP_000714) |
CNY 19,520.00 |
|
PH317910 | CACNB1 MS Standard C13 and N15-labeled recombinant protein (NP_954855) |
CNY 19,520.00 |
|
TP307230 | Recombinant protein of human calcium channel, voltage-dependent, beta 1 subunit (CACNB1), transcript variant 1, 20 µg |
CNY 2,900.00 |