SNF5 (SMARCB1) (NM_001007468) Human Recombinant Protein
CAT#: TP317885
Recombinant protein of human SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1 (SMARCB1), transcript variant 2, 20 µg
View other "SNF5" proteins (6)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC217885 protein sequence
Red=Cloning site Green=Tags(s) MMMMALSKTFGQKPVKFQLEDDGEFYMIGSEVGNYLRMFRGSLYKRYPSLWRRLATVEERKKIVASSHDH GYTTLATSVTLLKASEVEEILDGNDEKYKAVSISTEPPTYLREQKAKRNSQWVPTLPNSSHHLDAVPCST TINRNRMGRDKKRTFPLCFDDHDPAVIHENASQPEVLVPIRLDMEIDGQKLRDAFTWNMNEKLMTPEMFS EILCDDLDLNPLTFVPAIASAIRQQIESYPTDSILEDQSDQRVIIKLNIHVGNISLVDQFEWDMSEKENS PEKFALKLCSELGLGGEFVTTIAYSIRGQLSWHQKTYAFSENPLPTVEIAIRNTGDADQWCPLLETLTDA EMEKKIRDQDRNTRRMRRLANTAPAW myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 43 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001007469 |
Locus ID | 6598 |
UniProt ID | Q12824 |
Refseq Size | 1690 |
Cytogenetics | 22q11 |
Refseq ORF | 1128 |
Synonyms | BAF47; CSS3; hSNFS; INI1; MRD15; PPP1R144; RDT; RTPS1; Sfh1p; SNF5; SNF5L1; Snr1; SWNTS1 |
Summary | The protein encoded by this gene is part of a complex that relieves repressive chromatin structures, allowing the transcriptional machinery to access its targets more effectively. The encoded nuclear protein may also bind to and enhance the DNA joining activity of HIV-1 integrase. This gene has been found to be a tumor suppressor, and mutations in it have been associated with malignant rhabdoid tumors. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Dec 2015] |
Protein Families | Transcription Factors |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
A lncRNA-SWI/SNF complex crosstalk controls transcriptional activation at specific promoter regions
,Grossi, E;Raimondi, I;Goñi, E;González, J;Marchese, FP;Chapaprieta, V;Martín-Subero, JI;Guo, S;Huarte, M;,
Nat Commun
,PubMed ID 32071317
[SMARCB1]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401072 | SMARCB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC423489 | SMARCB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401072 | Transient overexpression lysate of SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1 (SMARCB1), transcript variant 1 |
CNY 3,080.00 |
|
LY423489 | Transient overexpression lysate of SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1 (SMARCB1), transcript variant 2 |
CNY 3,080.00 |
|
PH317885 | SMARCB1 MS Standard C13 and N15-labeled recombinant protein (NP_001007469) |
CNY 19,520.00 |
|
TP762311 | Purified recombinant protein of Human SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1 (SMARCB1), transcript variant 1, Glu246-Asn380, with N-terminal His tag, expressed in E.coli, 50ug |
CNY 1,950.00 |