MIA40 (CHCHD4) (NM_001098502) Human Recombinant Protein
CAT#: TP317831
Recombinant protein of human coiled-coil-helix-coiled-coil-helix domain containing 4 (CHCHD4), nuclear gene encoding mitochondrial protein, transcript variant 1, 20 µg
View other "MIA40" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CN¥ 2,900.00
CN¥ 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC217831 representing NM_001098502
Red=Cloning site Green=Tags(s) MSYCRQEGKDRIIFVTKEDHETPSSAELVADDPNDPYEEHGLILPNGNINWNCPCLGGMASGPCGEQFKS AFSCFHYSTEEIKGSDCVDQFRAMQECMQKYPDLYPQEDEDEEEEREKKPAEQAEETAPIEATATKEEEG SS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 15.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001091972 |
Locus ID | 131474 |
UniProt ID | Q8N4Q1 |
Refseq Size | 1476 |
Cytogenetics | 3p25.1 |
Refseq ORF | 426 |
Synonyms | MIA40; TIMM40 |
Summary | CHCHD4, a component of human mitochondria, belongs to a protein family whose members share 6 highly conserved cysteine residues constituting a -CXC-CX(9)C-CX(9)C- motif in the C terminus (Hofmann et al., 2005 [PubMed 16185709]).[supplied by OMIM, Mar 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC420602 | CHCHD4 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY420602 | Transient overexpression lysate of coiled-coil-helix-coiled-coil-helix domain containing 4 (CHCHD4), nuclear gene encoding mitochondrial protein, transcript variant 1 |
CN¥ 3,080.00 |
|
PH317831 | CHCHD4 MS Standard C13 and N15-labeled recombinant protein (NP_001091972) |
CN¥ 19,520.00 |