REPS2 (NM_004726) Human Recombinant Protein
CAT#: TP317778
Recombinant protein of human RALBP1 associated Eps domain containing 2 (REPS2), transcript variant 1, 20 µg
View other "REPS2" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC217778 representing NM_004726
Red=Cloning site Green=Tags(s) MEAAAAAAAAAAAAAAAGGGCGSGPPPLLLSEGEQQCYSELFARCAGAAGGGPGSGPPEAARVAPGTATA AAGPVADLFRASQLPAETLHQITELCGAKRVGYFGPTQFYIALKLIAAAQSGLPVRIESIKCELPLPRFM MSKNDGEIRFGNPAELHGTKVQIPYLTTEKNSFKRMDDEDKQQETQSPTMSPLASPPSSPPHYQRVPLSH GYSKLRSSAEQMHPAPYEARQPLVQPEGSSSGGPGTKPLRHQASLIRSFSVERELQDNSSYPDEPWRITE EQREYYVNQFRSLQPDPSSFISGSVAKNFFTKSKLSIPELSYIWELSDADCDGALTLPEFCAAFHLIVAR KNGYPLPEGLPPTLQPEYLQAAFPKPKWDCQLFDSYSESLPANQQPRDLNRMEKTSVKDMADLPVPNQDV TSDDKQALKSTINEALPKDVSEDPATPKDSNSLKARPRSRSYSSTSIEEAMKRGEDPPTPPPRPQKTHSR ASSLDLNKVFQPSVPATKSGLLPPPPALPPRPCPSQSEQVSEAELLPQLSRAPSQAAESSPAKKDVLYSQ PPSKPIRRKFRPENQATENQEPSTAASGPASAATMKPHPTVQKQSSKQKKAIQTAIRKNKEANAVLARLN SELQQQLKEVHQERIALENQLEQLRPVTVL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 71.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004717 |
Locus ID | 9185 |
UniProt ID | Q8NFH8 |
Refseq Size | 7964 |
Cytogenetics | Xp22.2 |
Refseq ORF | 1980 |
Synonyms | POB1 |
Summary | The product of this gene is part of a protein complex that regulates the endocytosis of growth factor receptors. The encoded protein directly interacts with a GTPase activating protein that functions downstream of the small G protein Ral. Its expression can negatively affect receptor internalization and inhibit growth factor signaling. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417796 | REPS2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC421142 | REPS2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY417796 | Transient overexpression lysate of RALBP1 associated Eps domain containing 2 (REPS2), transcript variant 1 |
CNY 4,840.00 |
|
LY421142 | Transient overexpression lysate of RALBP1 associated Eps domain containing 2 (REPS2), transcript variant 2 |
CNY 4,840.00 |
|
PH317778 | REPS2 MS Standard C13 and N15-labeled recombinant protein (NP_004717) |
CNY 19,520.00 |
|
PH317830 | REPS2 MS Standard C13 and N15-labeled recombinant protein (NP_001074444) |
CNY 14,250.00 |
|
TP317830 | Recombinant protein of human RALBP1 associated Eps domain containing 2 (REPS2), transcript variant 2, 20 µg |
CNY 2,900.00 |