DEFB124 (NM_001037500) Human Recombinant Protein
CAT#: TP317724
Recombinant protein of human defensin, beta 124 (DEFB124), 20 µg
View other "DEFB124" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC217724 representing NM_001037500
Red=Cloning site Green=Tags(s) MTQLLLFLVALLVLGHVPSGRSEFKRCWKGQGACQTYCTRQETYMHLCPDASLCCLSYALKPPPVPKHEY E myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 7.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001032589 |
Locus ID | 245937 |
UniProt ID | Q8NES8 |
Refseq Size | 216 |
Cytogenetics | 20q11.21 |
Refseq ORF | 213 |
Synonyms | DEFB-24 |
Summary | Defensins are cysteine-rich cationic polypeptides that are important in the host immunologic response to invading microorganisms. This antimicrobial protein is secreted and is a member of the beta defensin protein family. Beta defensin genes are found in several clusters throughout the genome, with this gene mapping to a cluster at 20q11.1. The encoded protein may serve to enhance innate immunity in the prostate. [provided by RefSeq, Nov 2014] |
Protein Families | Secreted Protein |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Beta-Defensin 124 Is Required for Efficient Innate Immune Responses in Prostate Epithelial RWPE-1 Cells
,null,
Korean Journal of Urology
,PubMed ID 24955228
[DEFB124]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC421916 | DEFB124 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY421916 | Transient overexpression lysate of defensin, beta 124 (DEFB124) |
CNY 3,080.00 |
|
PH317724 | DEFB124 MS Standard C13 and N15-labeled recombinant protein (NP_001032589) |
CNY 19,520.00 |
其它DEFB124产品