DEFB124 (NM_001037500) Human Mass Spec Standard
CAT#: PH317724
DEFB124 MS Standard C13 and N15-labeled recombinant protein (NP_001032589)
View other "DEFB124" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | DEFB124 MS Standard C13 and N15-labeled recombinant protein (NP_001032589) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC217724 |
Predicted MW | 7.9 kDa |
Protein Sequence |
>RC217724 representing NM_001037500
Red=Cloning site Green=Tags(s) MTQLLLFLVALLVLGHVPSGRSEFKRCWKGQGACQTYCTRQETYMHLCPDASLCCLSYALKPPPVPKHEY E myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001032589 |
RefSeq Size | 216 |
RefSeq ORF | 213 |
Synonyms | DEFB-24 |
Locus ID | 245937 |
Cytogenetics | 20q11.21 |
Summary | Defensins are cysteine-rich cationic polypeptides that are important in the host immunologic response to invading microorganisms. This antimicrobial protein is secreted and is a member of the beta defensin protein family. Beta defensin genes are found in several clusters throughout the genome, with this gene mapping to a cluster at 20q11.1. The encoded protein may serve to enhance innate immunity in the prostate. [provided by RefSeq, Nov 2014] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC421916 | DEFB124 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY421916 | Transient overexpression lysate of defensin, beta 124 (DEFB124) |
CNY 3,080.00 |
|
TP317724 | Recombinant protein of human defensin, beta 124 (DEFB124), 20 µg |
CNY 2,900.00 |
其它DEFB124产品