SIAT4A (ST3GAL1) (NM_003033) Human Recombinant Protein
CAT#: TP317696
Recombinant protein of human ST3 beta-galactoside alpha-2,3-sialyltransferase 1 (ST3GAL1), transcript variant 1, 20 µg
View other "SIAT4A" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC217696 protein sequence
Red=Cloning site Green=Tags(s) MVTLRKRTLKVLTFLVLFIFLTSFFLNYSHTMVATTWFPKQMVLELSENLKRLIKHRPCTCTHCIGQRKL SAWFDERFNQTMQPLLTAQNALLEDDTYRWWLRLQREKKPNNLNDTIKELFRVVPGNVDPMLEKRSVGCR RCAVVGNSGNLRESSYGPEIDSHDFVLRMNKAPTAGFEADVGTKTTHHLVYPESFRELGDNVSMILVPFK TIDLEWVVSAITTGTISHTYIPVPAKIRVKQDKILIYHPAFIKYVFDNWLQGHGRYPSTGILSVIFSMHV CDEVDLYGFGADSKGNWHHYWENNPSAGAFRKTGVHDADFESNVTATLASINKIRIFKGR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 38.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_003024 |
Locus ID | 6482 |
UniProt ID | Q11201 |
Refseq Size | 6971 |
Cytogenetics | 8q24.22 |
Refseq ORF | 1020 |
Synonyms | 1; Gal-NAc6S; SIAT4A; SIATFL; ST3GalA; ST3GalA.1; ST3GalIA; ST3O |
Summary | The protein encoded by this gene is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The encoded protein is normally found in the Golgi but can be proteolytically processed to a soluble form. Correct glycosylation of the encoded protein may be critical to its sialyltransferase activity. This protein, which is a member of glycosyltransferase family 29, can use the same acceptor substrates as does sialyltransferase 4B. Two transcript variants encoding the same protein have been found for this gene. Other transcript variants may exist, but have not been fully characterized yet. [provided by RefSeq, Jul 2008] |
Protein Families | Secreted Protein, Transmembrane |
Protein Pathways | Glycosphingolipid biosynthesis - ganglio series, Glycosphingolipid biosynthesis - globo series, Keratan sulfate biosynthesis, Metabolic pathways, O-Glycan biosynthesis |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403550 | ST3GAL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC418931 | ST3GAL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403550 | Transient overexpression lysate of ST3 beta-galactoside alpha-2,3-sialyltransferase 1 (ST3GAL1), transcript variant 2 |
CNY 3,080.00 |
|
LY418931 | Transient overexpression lysate of ST3 beta-galactoside alpha-2,3-sialyltransferase 1 (ST3GAL1), transcript variant 1 |
CNY 3,080.00 |
|
PH317696 | ST3GAL1 MS Standard C13 and N15-labeled recombinant protein (NP_003024) |
CNY 19,520.00 |