RNPS1 (NM_006711) Human Recombinant Protein
CAT#: TP317673
Recombinant protein of human RNA binding protein S1, serine-rich domain (RNPS1), transcript variant 1, 20 µg
View other "RNPS1" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC217673 representing NM_006711
Red=Cloning site Green=Tags(s) MDLSGVKKKSLLGVKENNKKSSTRAPSPTKRKDRSDEKSKDRSKDKGATKESSEKDRGRDKTRKRRSASS GSSSTRSRSSSTSSSGSSTSTGSSSGSSSSSASSRSGSSSTSRSSSSSSSSGSPSPSRRRHDNRRRSRSK SKPPKRDEKERKRRSPSPKPTKVHIGRLTRNVTKDHIMEIFSTYGKIKMIDMPVERMHPHLSKGYAYVEF ENPDEAEKALKHMDGGQIDGQEITATAVLAPWPRPPPRRFSPPRRMLPPPPMWRRSPPRMRRRSRSPRRR SPVRRRSRSPGRRRHRSRSSSNSSR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 34 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006702 |
Locus ID | 10921 |
UniProt ID | Q15287 |
Refseq Size | 2038 |
Cytogenetics | 16p13.3 |
Refseq ORF | 915 |
Synonyms | E5.1 |
Summary | This gene encodes a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. mRNA surveillance detects exported mRNAs with truncated open reading frames and initiates nonsense-mediated mRNA decay (NMD). When translation ends upstream from the last exon-exon junction, this triggers NMD to degrade mRNAs containing premature stop codons. This protein binds to the mRNA and remains bound after nuclear export, acting as a nucleocytoplasmic shuttling protein. This protein contains many serine residues. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2013] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409141 | RNPS1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC416470 | RNPS1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409141 | Transient overexpression lysate of RNA binding protein S1, serine-rich domain (RNPS1), transcript variant 2 |
CNY 3,080.00 |
|
LY416470 | Transient overexpression lysate of RNA binding protein S1, serine-rich domain (RNPS1), transcript variant 1 |
CNY 3,080.00 |
|
PH315882 | RNPS1 MS Standard C13 and N15-labeled recombinant protein (NP_542161) |
CNY 19,520.00 |
|
PH317673 | RNPS1 MS Standard C13 and N15-labeled recombinant protein (NP_006702) |
CNY 19,520.00 |
|
TP315882 | Recombinant protein of human RNA binding protein S1, serine-rich domain (RNPS1), transcript variant 2, 20 µg |
CNY 2,900.00 |