CCL14 (NM_004166) Human Recombinant Protein
CAT#: TP317672
Recombinant protein of human chemokine (C-C motif) ligand 14 (CCL14), transcript variant 1, 20 µg
View other "CCL14" proteins (8)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC217672 representing NM_004166
Red=Cloning site Green=Tags(s) MKISVAAIPFFLLITIALGTKTESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKR GHSVCTNPSDKWVQDYIKDMKEN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 8.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004157 |
Locus ID | 6358 |
UniProt ID | Q16627 |
Refseq Size | 1344 |
Cytogenetics | 17q12 |
Refseq ORF | 279 |
Synonyms | CC-1; CC-3; CKb1; FLJ16015; HCC-1; HCC-3; MCIF; NCC-2; NCC2; SCYA14; SCYL2; SY14 |
Summary | This gene, chemokine (C-C motif) ligand 14, is one of several CC cytokine genes clustered on 17q11.2. The CC cytokines are secreted proteins characterized by two adjacent cysteines. The cytokine encoded by this gene induces changes in intracellular calcium concentration and enzyme release in monocytes. Multiple transcript variants encoding different isoforms have been found for this gene. Read-through transcripts are also expressed that include exons from the upstream cytokine gene, chemokine (C-C motif) ligand 15, and are represented as GeneID: 348249. [provided by RefSeq, Dec 2009] |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Chemokine signaling pathway, Cytokine-cytokine receptor interaction |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409847 | CCL14 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC418173 | CCL14 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409847 | Transient overexpression lysate of chemokine (C-C motif) ligand 14 (CCL14), transcript variant 3 |
CNY 3,080.00 |
|
LY418173 | Transient overexpression lysate of chemokine (C-C motif) ligand 14 (CCL14), transcript variant 1 |
CNY 3,080.00 |
|
PH308370 | CCL14 MS Standard C13 and N15-labeled recombinant protein (NP_116739) |
CNY 19,520.00 |
|
PH317672 | CCL14 MS Standard C13 and N15-labeled recombinant protein (NP_004157) |
CNY 19,520.00 |
|
TP308370 | Recombinant protein of human chemokine (C-C motif) ligand 14 (CCL14), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
TP720662 | Purified recombinant protein of Human chemokine (C-C motif) ligand 14 (CCL14), transcript variant 3 |
CNY 3,140.00 |