TICAM2 (NM_021649) Human Recombinant Protein
CAT#: TP317645
Recombinant protein of human toll-like receptor adaptor molecule 2 (TICAM2), 20 µg
View other "TICAM2" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC217645 representing NM_021649
Red=Cloning site Green=Tags(s) MGIGKSKINSCPLSLSWGKRHSVDTSPGYHESDSKKSEDLSLCNVAEHSNTTEGPTGKQEGAQSVEEMFE EEAEEEVFLKFVILHAEDDTDEALRVQNLLQDDFGIKPGIIFAEMPCGRQHLQNLDDAVNGSAWTILLLT ENFLRDTWCNFQFYTSLMNSVNRQHKYNSVIPMRPLNNPLPRERTPFALQTINALEEESRGFPTQVERIF QESVYKTQQTIWKETRNMVQRQFIA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 26.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_067681 |
Locus ID | 353376 |
UniProt ID | Q86XR7 |
Refseq Size | 3453 |
Cytogenetics | 5q22.3 |
Refseq ORF | 705 |
Synonyms | MyD88-4; TICAM-2; TIRAP3; TIRP; TRAM |
Summary | TIRP is a Toll/interleukin-1 receptor (IL1R; MIM 147810) (TIR) domain-containing adaptor protein involved in Toll receptor signaling (see TLR4; MIM 603030).[supplied by OMIM, Apr 2004] |
Protein Families | Druggable Genome |
Protein Pathways | Toll-like receptor signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402870 | TICAM2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402870 | Transient overexpression lysate of toll-like receptor adaptor molecule 2 (TICAM2) |
CNY 3,080.00 |
|
PH317645 | TICAM2 MS Standard C13 and N15-labeled recombinant protein (NP_067681) |
CNY 19,520.00 |