OST beta (SLC51B) (NM_178859) Human Recombinant Protein
CAT#: TP317638
Recombinant protein of human organic solute transporter beta (OSTbeta), 20 µg
View other "OST beta" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CN¥ 2,900.00
CN¥ 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC217638 protein sequence
Red=Cloning site Green=Tags(s) MEHSEGAPGDPAGTVVPQELLEEMLWFFRVEDASPWNHSILALAAVVVIISMVLLGRSIQASRKEKMQPP EKETPEVLHLDEAKDHNSLNNLRETLLSEKPNLAQVELELKERDVLSVFLPDVPETES myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 14.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_849190 |
Locus ID | 123264 |
UniProt ID | Q86UW2 |
Refseq Size | 940 |
Cytogenetics | 15q22.31 |
Refseq ORF | 384 |
Synonyms | OSTB; OSTBETA |
Summary | Essential component of the Ost-alpha/Ost-beta complex, a heterodimer that acts as the intestinal basolateral transporter responsible for bile acid export from enterocytes into portal blood. Efficiently transports the major species of bile acids. Modulates SLC51A glycosylation, membrane trafficking and stability activities.[UniProtKB/Swiss-Prot Function] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405823 | SLC51B HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY405823 | Transient overexpression lysate of organic solute transporter beta (OSTBETA) |
CN¥ 3,080.00 |
|
PH317638 | OSTBETA MS Standard C13 and N15-labeled recombinant protein (NP_849190) |
CN¥ 19,520.00 |
其它OST beta产品