United States
Germany
Japan
United Kingdom
China
RASSF2 (NM_170774) Human Recombinant Protein
CAT＃: TP317404
Recombinant protein of human Ras association (RalGDS/AF-6) domain family member 2 (RASSF2), transcript variant 2, 20 µg
View other "RASSF2" proteins (8)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
CNY 6,281.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC217404 protein sequence
Red=Cloning site Green=Tags(s) MDYSHQTSLVPCGQDKYISKNELLLHLKTYNLYYEGQNLQLRHREEEDEFIVEGLLNISWGLRRPIRLQM QDDNERIRPPPSSSSWHSGCNLGAQGTTLKPLTVPKVQISEVDAPPEGDQMPSSTDSRGLKPLQEDTPQL MRTRSDVGVRRRGNVRTPSDQRRIRRHRFSINGHFYNHKTSVFTPAYGSVTNVRINSTMTTPQVLKLLLN KFKIENSAEEFALYVVHTSGEKQKLKATDYPLIARILQGPCEQISKVFLMEKDQVEEVTYDVAQYIKFEM PVLKSFIQKLQEEEDREVKKLMRKYTVLRLMIRQRLEEIAETPATI myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 37.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_739580 |
| Locus ID | 9770 |
| UniProt ID | P50749 |
| Refseq Size | 5307 |
| Cytogenetics | 20p13 |
| Refseq ORF | 978 |
| Synonyms | CENP-34; RASFADIN |
| Summary | This gene encodes a protein that contains a Ras association domain. Similar to its cattle and sheep counterparts, this gene is located near the prion gene. Two alternatively spliced transcripts encoding the same isoform have been reported. [provided by RefSeq, Jul 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC406875 | RASSF2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC415073 | RASSF2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC429435 | RASSF2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY406875 | Transient overexpression lysate of Ras association (RalGDS/AF-6) domain family member 2 (RASSF2), transcript variant 2 |
CNY 3,080.00 |
|
| LY415073 | Transient overexpression lysate of Ras association (RalGDS/AF-6) domain family member 2 (RASSF2), transcript variant 1 |
CNY 3,080.00 |
|
| PH316299 | RASSF2 MS Standard C13 and N15-labeled recombinant protein (NP_055552) |
CNY 19,520.00 |
|
| PH317404 | RASSF2 MS Standard C13 and N15-labeled recombinant protein (NP_739580) |
CNY 19,520.00 |
|
| TP316299 | Recombinant protein of human Ras association (RalGDS/AF-6) domain family member 2 (RASSF2), transcript variant 1, 20 µg |
CNY 2,900.00 |
