HMGA1 (NM_145904) Human Recombinant Protein
CAT#: TP317302M
Recombinant protein of human high mobility group AT-hook 1 (HMGA1), transcript variant 6, 100 µg
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 9,998.00
货期*
4周
规格
经常一起买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC217302 protein sequence
Red=Cloning site Green=Tags(s) MSESSSKSSQPLASKQEKDGTEKRGRGRPRKQPPVSPGTALVGSQKEPSEVPTPKRPRGRPKGSKNKGAA KTRKTTTTPGRKPRGRPKKLEKEEEEGISQESSEEEQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 11.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_665911 |
Locus ID | 3159 |
UniProt ID | P17096 |
Refseq Size | 1978 |
Cytogenetics | 6p21.31 |
Refseq ORF | 321 |
Synonyms | AL023995; high mobility group AT-hook 1; high mobility group protein I; HMG-I(Y); HMG-R, HMGIY, HMGA1A, MGC4242, MGC4854, MGC12816; Hmga1a; Hmga1b; Hmgi; HMGI(Y); Hmgiy; HMGY; MGC102580 |
Summary | This gene encodes a chromatin-associated protein involved in the regulation of gene transcription, integration of retroviruses into chromosomes, and the metastatic progression of cancer cells. The encoded protein preferentially binds to the minor groove of AT-rich regions in double-stranded DNA. Multiple transcript variants encoding different isoforms have been found for this gene. Pseudogenes of this gene have been identified on multiple chromosomes. [provided by RefSeq, Jan 2016] |
Protein Families | Druggable Genome, Stem cell - Pluripotency, Stem cell relevant signaling - JAK/STAT signaling pathway, Transcription Factors |
Documents
FAQs |
SDS |
You may also need
Customer
Reviews
Loading...