Guanylin (GUCA2A) (NM_033553) Human Recombinant Protein
CAT#: TP317195
Recombinant protein of human guanylate cyclase activator 2A (guanylin) (GUCA2A), 20 µg
View other "Guanylin" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC217195 representing NM_033553
Red=Cloning site Green=Tags(s) MNAFLLSALCLLGAWAALAGGVTVQDGNFSFSLESVKKLKDLQEPQEPRVGKLRNFAPIPGEPVVPILCS NPNFPEELKPLCKEPNAQEILQRLEEIAEDPGTCEICAYAACTGC myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 12.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_291031 |
Locus ID | 2980 |
UniProt ID | Q02747 |
Refseq Size | 575 |
Cytogenetics | 1p34.2 |
Refseq ORF | 345 |
Synonyms | GCAP-I; GUCA2; STARA |
Summary | Endogenous activator of intestinal guanylate cyclase. It stimulates this enzyme through the same receptor binding region as the heat-stable enterotoxins.[UniProtKB/Swiss-Prot Function] |
Protein Families | Secreted Protein, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409429 | GUCA2A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409429 | Transient overexpression lysate of guanylate cyclase activator 2A (guanylin) (GUCA2A) |
CNY 3,080.00 |
|
PH317195 | GUCA2A MS Standard C13 and N15-labeled recombinant protein (NP_291031) |
CNY 19,520.00 |
其它Guanylin产品