POFUT1 (NM_015352) Human Recombinant Protein
CAT#: TP317185
Recombinant protein of human protein O-fucosyltransferase 1 (POFUT1), transcript variant 1, 20 µg
View other "POFUT1" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC217185 representing NM_015352
Red=Cloning site Green=Tags(s) MGAAAWARPLSVSFLLLLLPLPGMPAGSWDPAGYLLYCPCMGRFGNQADHFLGSLAFAKLLNRTLAVPPW IEYQHHKPPFTNLHVSYQKYFKLEPLQAYHRVISLEDFMEKLAPTHWPPEKRVAYCFEVAAQRSPDKKTC PMKEGNPFGPFWDQFHVSFNKSELFTGISFSASYREQWSQRFSPKEHPVLALPGAPAQFPVLEEHRPLQK YMVWSDEMVKTGEAQIHAHLVRPYVGIHLRIGSDWKNACAMLKDGTAGSHFMASPQCVGYSRSTAAPLTM TMCLPDLKEIQRAVKLWVRSLDAQSVYVATDSESYVPELQQLFKGKVKVVSLKPEVAQVDLYILGQADHF IGNCVSSFTAFVKRERDLQGRPSSFFGMDRPPKLRDEF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 41.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_056167 |
Locus ID | 23509 |
UniProt ID | Q9H488 |
Refseq Size | 5249 |
Cytogenetics | 20q11.21 |
Refseq ORF | 1164 |
Synonyms | DDD2; FUT12; O-Fuc-T; O-FucT-1; O-FUT; OFUCT1 |
Summary | This gene encodes a member of the glycosyltransferase O-Fuc family. This enzyme adds O-fucose through an O-glycosidic linkage to conserved serine or threonine residues in the epidermal growth factor-like repeats of a number of cell surface and secreted proteins. O-fucose glycans are involved in ligand-induced receptor signaling. Alternative splicing of this gene results in two transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406756 | POFUT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC414612 | POFUT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY406756 | Transient overexpression lysate of protein O-fucosyltransferase 1 (POFUT1), transcript variant 2 |
CNY 3,080.00 |
|
LY414612 | Transient overexpression lysate of protein O-fucosyltransferase 1 (POFUT1), transcript variant 1 |
CNY 3,080.00 |
|
PH317185 | POFUT1 MS Standard C13 and N15-labeled recombinant protein (NP_056167) |
CNY 19,520.00 |