FAM108B1 (ABHD17B) (NM_016014) Human Recombinant Protein
CAT#: TP317164
Recombinant protein of human family with sequence similarity 108, member B1 (FAM108B1), transcript variant 1, 20 µg
View other "FAM108B1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC217164 representing NM_016014
Red=Cloning site Green=Tags(s) MNNLSFSELCCLFCCPPCPGKIASKLAFLPPDPTYTLMCDESGSRWTLHLSERADWQYSSREKDAIECFM TRTSKGNRIACMFVRCSPNAKYTLLFSHGNAVDLGQMSSFYIGLGSRINCNIFSYDYSGYGASSGKPTEK NLYADIEAAWLALRTRYGIRPENVIIYGQSIGTVPSVDLAARYESAAVILHSPLTSGMRVAFPDTKKTYC FDAFPNIDKISKITSPVLIIHGTEDEVIDFSHGLALFERCQRPVEPLWVEGAGHNDVELYGQYLERLKQF VSQELVQKHKEGK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 32.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_057098 |
Locus ID | 51104 |
UniProt ID | Q5VST6 |
Refseq Size | 1614 |
Cytogenetics | 9q21.13 |
Refseq ORF | 879 |
Synonyms | C9orf77; CGI-67; FAM108B1 |
Summary | Hydrolyzes fatty acids from S-acylated cysteine residues in proteins (PubMed:26701913). Has depalmitoylating activity towards DLG4/PSD95 (PubMed:26701913). Has depalmitoylating activity towards GAP43 (By similarity). Has depalmitoylating activity towards MAP6 (By similarity). Has depalmitoylating activity towards NRAS (PubMed:26701913).[UniProtKB/Swiss-Prot Function] |
Protein Families | Protease |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414254 | ABHD17B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414254 | Transient overexpression lysate of family with sequence similarity 108, member B1 (FAM108B1), transcript variant 1 |
CNY 3,080.00 |
|
PH317164 | FAM108B1 MS Standard C13 and N15-labeled recombinant protein (NP_057098) |
CNY 19,520.00 |
其它FAM108B1产品