AFMID (NM_001010982) Human Recombinant Protein
CAT#: TP317126
Recombinant protein of human arylformamidase (AFMID), transcript variant 1, 20 µg
View other "AFMID" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC217126 representing NM_001010982
Red=Cloning site Green=Tags(s) MMDVSGVGFPSKVPWKKMSAEELENQYCPSRWVVRLGAEEALRTYSQIGIEATTRARATRKSLLHVPYGD GEGEKVDIYFPDESSEALPFFLFFHGGYWQSGSKDESAFMVHPLTAQGVAVVIVAYGIAPKGTLDHMVDQ VTRSVAFVQKRYPSNKGIYLCGHSAGAHLAAMMLLADWTKHGVTPNLRGFFLVSGVFDLEPIVYTSQNVA LQLTLEDAQRNSPQLKVAQAQPVDPTCRVLVVVGQFDSPEFHRQSWEFYQTLCQGEWKASFEELHDVDHF EIVENLTQKDNVLTQIILKTIFQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 33.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001010982 |
Locus ID | 125061 |
UniProt ID | Q63HM1 |
Refseq Size | 1820 |
Cytogenetics | 17q25.3 |
Refseq ORF | 909 |
Synonyms | FKF; KF; KFA |
Summary | Catalyzes the hydrolysis of N-formyl-L-kynurenine to L-kynurenine, the second step in the kynurenine pathway of tryptophan degradation. Kynurenine may be further oxidized to nicotinic acid, NAD(H) and NADP(H). Required for elimination of toxic metabolites.[UniProtKB/Swiss-Prot Function] |
Protein Pathways | Glyoxylate and dicarboxylate metabolism, Metabolic pathways, Tryptophan metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC423254 | AFMID HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY423254 | Transient overexpression lysate of arylformamidase (AFMID), transcript variant 1 |
CNY 3,080.00 |
|
PH317126 | AFMID MS Standard C13 and N15-labeled recombinant protein (NP_001010982) |
CNY 19,520.00 |
|
TP760832 | Purified recombinant protein of Human arylformamidase (AFMID), transcript variant 2, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2,040.00 |