United States
Germany
Japan
United Kingdom
China
M-CSF (CSF1) (NM_000757) Human Recombinant Protein
CAT＃: TP317104
Recombinant protein of human colony stimulating factor 1 (macrophage) (CSF1), transcript variant 1, 20 µg
View other "M-CSF" proteins (19)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC217104 protein sequence
Red=Cloning site Green=Tags(s) MTAPGAAGRCPPTTWLGSLLLLVCLLASRSITEEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFV DQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYE TPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQDVVTKPDCNCLYPKAIPSSDPASVSPHQP LAPSMAPVAGLTWEDSEGTEGSSLLPGEQPLHTVDPGSAKQRPPRSTCQSFEPPETPVVKDSTIGGSPQP RPSVGAFNPGMEDILDSAMGTNWVPEEASGEASEIPVPQGTELSPSRPGGGSMQTEPARPSNFLSASSPL PASAKGQQPADVTGTALPRVGPVRPTGQDWNHTPQKTDHPSALLRDPPEPGSPRISSLRPQGLSNPSTLS AQPQLSRSHSSGSVLPLGELEGRRSTRDRRSPAEPEGGPASEGAARPLPRFNSVPLTDTGHERQSEGSSS PQLQESVFHLLVPSVILVLLAVGGLLFYRWRRRSHQEPQRADSPLEQPEGSPLTQDDRQVELPV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 59.9 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_000748 |
| Locus ID | 1435 |
| UniProt ID | P09603 |
| Refseq Size | 4249 |
| Cytogenetics | 1p13.3 |
| Refseq ORF | 1662 |
| Synonyms | CSF-1; MCSF |
| Summary | The protein encoded by this gene is a cytokine that controls the production, differentiation, and function of macrophages. The active form of the protein is found extracellularly as a disulfide-linked homodimer, and is thought to be produced by proteolytic cleavage of membrane-bound precursors. The encoded protein may be involved in development of the placenta. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Sep 2011] |
| Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein, Transmembrane |
| Protein Pathways | Cytokine-cytokine receptor interaction, Hematopoietic cell lineage |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403534 | CSF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC406741 | CSF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC406742 | CSF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC424534 | CSF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC430359 | CSF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403534 | Transient overexpression lysate of colony stimulating factor 1 (macrophage) (CSF1), transcript variant 2 |
CNY 4,840.00 |
|
| LY406741 | Transient overexpression lysate of colony stimulating factor 1 (macrophage) (CSF1), transcript variant 3 |
CNY 3,080.00 |
|
| LY406742 | Transient overexpression lysate of colony stimulating factor 1 (macrophage) (CSF1), transcript variant 4 |
CNY 3,080.00 |
|
| LY424534 | Transient overexpression lysate of colony stimulating factor 1 (macrophage) (CSF1), transcript variant 1 |
CNY 3,080.00 |
|
| LY430359 | Transient overexpression lysate of colony stimulating factor 1 (macrophage) (CSF1), transcript variant 4 |
CNY 3,080.00 |
|
| PH305855 | CSF1 MS Standard C13 and N15-labeled recombinant protein (NP_757351) |
CNY 19,520.00 |
|
| PH313103 | CSF1 MS Standard C13 and N15-labeled recombinant protein (NP_757349) |
CNY 19,520.00 |
|
| PH317104 | CSF1 MS Standard C13 and N15-labeled recombinant protein (NP_000748) |
CNY 19,520.00 |
|
| PH317172 | CSF1 MS Standard C13 and N15-labeled recombinant protein (NP_757350) |
CNY 19,520.00 |
|
| TP305855 | Recombinant protein of human colony stimulating factor 1 (macrophage) (CSF1), transcript variant 4, 20 µg |
CNY 2,900.00 |
|
| TP313103 | Recombinant protein of human colony stimulating factor 1 (macrophage) (CSF1), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP317172 | Recombinant protein of human colony stimulating factor 1 (macrophage) (CSF1), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
| TP720352 | Recombinant protein of human colony stimulating factor 1 (macrophage) (CSF1), transcript variant 1 |
CNY 1,800.00 |
|
| TP723739 | Purified recombinant protein of Human colony stimulating factor 1 (macrophage) (CSF1), transcript variant 4 |
CNY 3,560.00 |
