C1orf149 (MEAF6) (NM_022756) Human Recombinant Protein
CAT#: TP317049
Recombinant protein of human chromosome 1 open reading frame 149 (C1orf149), 20 µg
View other "C1orf149" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC217049 representing NM_022756
Red=Cloning site Green=Tags(s) MAMHNKAAPPQIPDTRRELAELVKRKQELAETLANLERQIYAFEGSYLEDTQMYGNIIRGWDRYLTNQKN SNSKNDRRNRKFKEAERLFSKSSVTSAAAVSALAGVQDQLIEKREPGSGTESDTSPDFHNQENEPSQEDP EDLDGSVQGVKPQKAASSTSSGSHHSSHKKRKNKNRHSPSGMFDYDFEIDLKLNKKPRADY myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 22.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_073593 |
Locus ID | 64769 |
UniProt ID | Q9HAF1 |
Refseq Size | 2167 |
Cytogenetics | 1p34.3 |
Refseq ORF | 603 |
Synonyms | C1orf149; CENP-28; EAF6; NY-SAR-91 |
Summary | This gene encodes a nuclear protein involved in transcriptional activation. The encoded protein may form a component of several different histone acetyltransferase complexes. There is a pseudogene for this gene on chromosome 2. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2012] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411575 | MEAF6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY411575 | Transient overexpression lysate of MYST/Esa1-associated factor 6 (MEAF6) |
CNY 3,080.00 |
|
PH317049 | MEAF6 MS Standard C13 and N15-labeled recombinant protein (NP_073593) |
CNY 19,520.00 |
|
TP760670 | Purified recombinant protein of Human MYST/Esa1-associated factor 6 (MEAF6), with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2,040.00 |
其它C1orf149产品