C1orf149 (MEAF6) Rabbit Polyclonal Antibody
CAT#: TA333700
Rabbit Polyclonal Anti-FLJ11730 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
CNY 9,998.00
Specifications
Product Data | |
Applications | IHC, WB |
Recommend Dilution | WB, IHC |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-FLJ11730 Antibody: synthetic peptide directed towards the N terminal of human FLJ11730. Synthetic peptide located within the following region: HNKAAPPQIPDTRRELAELVKRKQELAETLANLERQIYAFEGSYLEDTQM |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 23 kDa |
Gene Name | MYST/Esa1 associated factor 6 |
Database Link | |
Background | The screening of cDNA expression libraries from human tumors with serum antibody (SEREX) has proven to be a powerful method for identifying the repertoire of tumor antigens recognized by the immune system of cancer patients, referred to as the cancer immunome. In this regard, cancer/testis (CT) antigens are of particular interest because of their immunogenicity and restricted expression patterns. Synoivial sarcomas are striking with regard to CT antigen expression, however, highly expressed in sarcoma, CT antigens do not induce frequent humoral immune responses in sarcoma patients. Sera from two patients were used to immunoscreen cDNA libraries from two synovial sarcoma cell lines and normal testis, resulting in the identification of 113 distinct antigens. Sarcoma antigen NY-SAR-91 is one of them. |
Synonyms | C1orf149; CENP-28; EAF6; NY-SAR-91 |
Note | Immunogen sequence homology: Bovine:100%; Western clawed frog:100%; Chicken:100%; African clawed frog:100%; Green puffer:100%; Zebra finch:100%; Mouse:100%; Human:100%; Rat:100%; Zebrafish:92%; Atlantic salmon:92%; Rainbow smelt:85%; Filarial nematode wor |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |
其它C1orf149产品