REG3A (NM_138937) Human Recombinant Protein
CAT#: TP316966
Recombinant protein of human regenerating islet-derived 3 alpha (REG3A), transcript variant 3, 20 µg
View other "REG3A" proteins (14)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC216966 protein sequence
Red=Cloning site Green=Tags(s) MLPPMALPSVSWMLLSCLMLLSQVQGEEPQRELPSARIRCPKGSKAYGSHCYALFLSPKSWTDADLACQK RPSGNLVSVLSGAEGSFVSSLVKSIGNSYSYVWIGLHDPTQGTEPNGEGWEWSSSDVMNYFAWERNPSTI SSPGHCASLSRSTAFLRWKDYNCNVRLPYVCKFTD myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 16.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_620354 |
Locus ID | 5068 |
UniProt ID | Q06141 |
Refseq Size | 807 |
Cytogenetics | 2p12 |
Refseq ORF | 525 |
Synonyms | HIP; HIP/PAP; INGAP; PAP; PAP-H; PAP1; PBCGF; REG-III; REG3 |
Summary | This gene encodes a pancreatic secretory protein that may be involved in cell proliferation or differentiation. It has similarity to the C-type lectin superfamily. The enhanced expression of this gene is observed during pancreatic inflammation and liver carcinogenesis. The mature protein also functions as an antimicrobial protein with antibacterial activity. Alternate splicing results in multiple transcript variants that encode the same protein.[provided by RefSeq, Nov 2014] |
Protein Families | Druggable Genome, Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400917 | REG3A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC408477 | REG3A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC408478 | REG3A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC430071 | REG3A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400917 | Transient overexpression lysate of regenerating islet-derived 3 alpha (REG3A), transcript variant 1 |
CNY 3,080.00 |
|
LY408477 | Transient overexpression lysate of regenerating islet-derived 3 alpha (REG3A), transcript variant 3 |
CNY 3,080.00 |
|
LY408478 | Transient overexpression lysate of regenerating islet-derived 3 alpha (REG3A), transcript variant 2 |
CNY 3,080.00 |
|
LY430071 | Transient overexpression lysate of regenerating islet-derived 3 alpha (REG3A), transcript variant 2 |
CNY 3,080.00 |
|
PH307791 | REG3A MS Standard C13 and N15-labeled recombinant protein (NP_002571) |
CNY 19,520.00 |
|
PH316966 | REG3A MS Standard C13 and N15-labeled recombinant protein (NP_620354) |
CNY 19,520.00 |
|
PH323860 | REG3A MS Standard C13 and N15-labeled recombinant protein (NP_620355) |
CNY 19,520.00 |
|
TP307791 | Recombinant protein of human regenerating islet-derived 3 alpha (REG3A), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP323860 | Recombinant protein of human regenerating islet-derived 3 alpha (REG3A), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP701057 | Purified recombinant protein of Human regenerating islet-derived 3 alpha (REG3A), with C-terminal His tag, secretory expressed in HEK293 cells, 50ug |
CNY 7,106.00 |