United States
Germany
Japan
United Kingdom
China
A1CF (NM_138932) Human Recombinant Protein
CAT＃: TP316861
Recombinant protein of human APOBEC1 complementation factor (A1CF), transcript variant 2, 20 µg
View other "A1CF" proteins (9)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC216861 protein sequence
Red=Cloning site Green=Tags(s) MESNHKSGDGLSGTQKEAALRALVQRTGYSLVQENGQRKYGGPPPGWDAAPPERGCEIFIGKLPRDLFED ELIPLCEKIGKIYEMRMMMDFNGNNRGYAFVTFSNKVEAKNAIKQLNNYEIRNGRLLGVCASVDNCRLFV GGIPKTKKREEILSEMKKVTEGVVDVIVYPSAADKTKNRGFAFVEYESHRAAAMARRKLLPGRIQLWGHG IAVDWAEPEVEVDEDTMSSVKILYVRNLMLSTSEEMIEKEFNNIKPGAVERVKKIRDYAFVHFSNREDAV EAMKALNGKVLDGSPIEVTLAKPVDKDSYVRYTRGTGGRGTMLQGEYTYSLGQVYDPTTTYLGAPVFYAP QTYAAIPSLHFPATKGHLSNRAIIRAPSVREIYMNVPVGAAGVRGLGGRGYLAYTGLGRGYQVKGDKRED KLYDILPGMELTPMNPVTLKPQGIKLAPQILEEICQKNNWGQPVYQLHSAIGQDQRQLFLYKITIPALAS QNPAIHPFTPPKLSAFVDEAKTYAAEYTLQTLGIPTDGGDGTMATAAAAATAFPGYAVPNATAPVSAAQL KQAVTLGQDLAAYTTYEVYPTFAVTARGDGYGTF myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 65 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_620310 |
| Locus ID | 29974 |
| UniProt ID | Q9NQ94 |
| Refseq Size | 9293 |
| Cytogenetics | 10q11.23 |
| Refseq ORF | 1782 |
| Synonyms | ACF; ACF64; ACF65; APOBEC1CF; ASP |
| Summary | Mammalian apolipoprotein B mRNA undergoes site-specific C to U deamination, which is mediated by a multi-component enzyme complex containing a minimal core composed of APOBEC-1 and a complementation factor encoded by this gene. The gene product has three non-identical RNA recognition motifs and belongs to the hnRNP R family of RNA-binding proteins. It has been proposed that this complementation factor functions as an RNA-binding subunit and docks APOBEC-1 to deaminate the upstream cytidine. Studies suggest that the protein may also be involved in other RNA editing or RNA processing events. Several transcript variants encoding a few different isoforms have been found for this gene. [provided by RefSeq, Nov 2010] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC408475 | A1CF HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC408476 | A1CF HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC415195 | A1CF HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LY408475 | Transient overexpression lysate of APOBEC1 complementation factor (A1CF), transcript variant 2 |
CNY 4,840.00 |
|
| LY408476 | Transient overexpression lysate of APOBEC1 complementation factor (A1CF), transcript variant 3 |
CNY 4,840.00 |
|
| LY415195 | Transient overexpression lysate of APOBEC1 complementation factor (A1CF), transcript variant 1 |
CNY 4,840.00 |
|
| PH316861 | A1CF MS Standard C13 and N15-labeled recombinant protein (NP_620310) |
CNY 19,520.00 |
|
| PH316911 | A1CF MS Standard C13 and N15-labeled recombinant protein (NP_620311) |
CNY 19,520.00 |
|
| TP316911 | Recombinant protein of human APOBEC1 complementation factor (A1CF), transcript variant 3, 20 µg |
CNY 2,900.00 |
