GALK2 (NM_001001556) Human Recombinant Protein
CAT#: TP316527
Recombinant protein of human galactokinase 2 (GALK2), transcript variant 2, 20 µg
View other "GALK2" proteins (8)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC216527 representing NM_001001556
Red=Cloning site Green=Tags(s) MPVLYDRLLKLKEMFNSKFGSIPKFYVRAPGRVNIIGEHIDYCGYSVLPMAVEQDVLIAVEPVKTYALQL ANTNPLYPDFSTSANNIQIDKTKPLWHNYFLCGLKGIQEHFGLSNLTGMNCLVDGNIPPSSGLSSSSALV CCAGLVTLTVLGRNLSKVELAEICAKSERYIGTEGGGMDQSISFLAEEGTAKLIEFSPLRATDVKLPSGA VFVIANSCVEMNKAATSHFNIRVMECRLAAKLLAKYKSLQWDKVLRLEEVQAKLGISLEEMLLVTEDALH PEPYNPEEICRCLGISLEELRTQILSPNTQDVLIFKLYQRAKHVYSEAARVLQFKKICEEAPENMVQLLG ELMNQSHMSCRDMYECSCPELDQLVDICRKFGAQGSRLTGAGWGGCTVSMVPADKLPSFLANVHKAYYQR SDGSLAPEKQSLFATKPGGGALVLLEA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 49.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001001556 |
Locus ID | 2585 |
UniProt ID | Q01415 |
Refseq Size | 3208 |
Cytogenetics | 15q21.1-q21.2 |
Refseq ORF | 1341 |
Synonyms | GK2 |
Summary | This gene encodes a highly efficient N-acetylgalactosamine (GalNAc) kinase, which has galactokinase activity when galactose is present at high concentrations. The encoded protein is a member of the GHMP kinase family. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2017] |
Protein Families | Druggable Genome |
Protein Pathways | Amino sugar and nucleotide sugar metabolism, Galactose metabolism, Metabolic pathways |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400749 | GALK2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC424379 | GALK2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY400749 | Transient overexpression lysate of galactokinase 2 (GALK2), transcript variant 1 |
CNY 3,080.00 |
|
LY424379 | Transient overexpression lysate of galactokinase 2 (GALK2), transcript variant 2 |
CNY 4,840.00 |
|
PH300475 | GALK2 MS Standard C13 and N15-labeled recombinant protein (NP_002035) |
CNY 19,520.00 |
|
PH316527 | GALK2 MS Standard C13 and N15-labeled recombinant protein (NP_001001556) |
CNY 19,520.00 |
|
TP300475 | Recombinant protein of human galactokinase 2 (GALK2), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP721055 | Purified recombinant protein of Human galactokinase 2 (GALK2), transcript variant 1 |
CNY 3,140.00 |