United States
Germany
Japan
United Kingdom
China
Doublecortin (DCX) (NM_178151) Human Recombinant Protein
CAT＃: TP316349
Recombinant protein of human doublecortin (DCX), transcript variant 4, 20 µg
View other "Doublecortin" proteins (16)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC216349 protein sequence
Red=Cloning site Green=Tags(s) MELDFGHFDERDKTSRNMRGSRMNGLPSPTHSAHCSFYRTRTLQALSNEKKAKKVRFYRNGDRYFKGIVY AVSSDRFRSFDALLADLTRSLSDNINLPQGVRYIYTIDGSRKIGSMDELEEGESYVCSSDNFFKKVEYTK NVNPNWSVNVKTSANMKAPQSLASSNSAQARENKDFVRPKLVTIIRSGVKPRKAVRVLLNKKTAHSFEQV LTDITEAIKLETGVVKKLYTLDGKQVTCLHDFFGDDDVFIACGPEKFRYAQDDFSLDENECRVMKGNPSA TAGPKASPTPQKTSAKSPGPMRRSKSPADSANGTSSSQLSTPKSKQSPISTPTSPGSLRKHKDLYLPLSL DDSDSLGDSM myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 39.9 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_835364 |
| Locus ID | 1641 |
| UniProt ID | O43602 |
| Refseq Size | 9262 |
| Cytogenetics | Xq23 |
| Refseq ORF | 1080 |
| Synonyms | DBCN; DC; LISX; SCLH; XLIS |
| Summary | This gene encodes a member of the doublecortin family. The protein encoded by this gene is a cytoplasmic protein and contains two doublecortin domains, which bind microtubules. In the developing cortex, cortical neurons must migrate over long distances to reach the site of their final differentiation. The encoded protein appears to direct neuronal migration by regulating the organization and stability of microtubules. In addition, the encoded protein interacts with LIS1, the regulatory gamma subunit of platelet activating factor acetylhydrolase, and this interaction is important to proper microtubule function in the developing cortex. Mutations in this gene cause abnormal migration of neurons during development and disrupt the layering of the cortex, leading to epilepsy, cognitive disability, subcortical band heterotopia ("double cortex" syndrome) in females and lissencephaly ("smooth brain" syndrome) in males. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2010] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403598 | DCX HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC405947 | DCX HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC406000 | DCX HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC424646 | DCX HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC434187 | DCX HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403598 | Transient overexpression lysate of doublecortin (DCX), transcript variant 2 |
CNY 3,080.00 |
|
| LY405947 | Transient overexpression lysate of doublecortin (DCX), transcript variant 4 |
CNY 3,080.00 |
|
| LY406000 | Transient overexpression lysate of doublecortin (DCX), transcript variant 3 |
CNY 3,080.00 |
|
| LY424646 | Transient overexpression lysate of doublecortin (DCX), transcript variant 1 |
CNY 4,840.00 |
|
| LY434187 | Transient overexpression lysate of doublecortin (DCX), transcript variant 5 |
CNY 3,080.00 |
|
| PH306454 | DCX MS Standard C13 and N15-labeled recombinant protein (NP_835366) |
CNY 19,520.00 |
|
| PH316349 | DCX MS Standard C13 and N15-labeled recombinant protein (NP_835364) |
CNY 19,520.00 |
|
| PH321891 | DCX MS Standard C13 and N15-labeled recombinant protein (NP_835365) |
CNY 19,520.00 |
|
| TP306454 | Recombinant protein of human doublecortin (DCX), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
| TP321891 | Recombinant protein of human doublecortin (DCX), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP331188 | Purified recombinant protein of Homo sapiens doublecortin (DCX), transcript variant 5, 20 µg |
CNY 2,900.00 |
其它Doublecortin产品
