KCNJ9 (NM_004983) Human Recombinant Protein
CAT#: TP316336
Recombinant protein of human potassium inwardly-rectifying channel, subfamily J, member 9 (KCNJ9), 20 µg
View other "KCNJ9" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC216336 representing NM_004983
Red=Cloning site Green=Tags(s) MAQENAAFSPGQEEPPRRRGRQRYVEKDGRCNVQQGNVRETYRYLTDLFTTLVDLQWRLSLLFFVLAYAL TWLFFGAIWWLIAYGRGDLEHLEDTAWTPCVNNLNGFVAAFLFSIETETTIGYGHRVITDQCPEGIVLLL LQAILGSMVNAFMVGCMFVKISQPNKRAATLVFSSHAVVSLRDGRLCLMFRVGDLRSSHIVEASIRAKLI RSRQTLEGEFIPLHQTDLSVGFDTGDDRLFLVSPLVISHEIDAASPFWEASRRALERDDFEIVVILEGMV EATGMTCQARSSYLVDEVLWGHRFTSVLTLEDGFYEVDYASFHETFEVPTPSCSARELAEAAARLDAHLY WSIPSRLDEKVEEEGAGEGAGGEAGADKEQNGCLPPPESESKV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 43.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004974 |
Locus ID | 3765 |
UniProt ID | Q92806 |
Refseq Size | 3029 |
Cytogenetics | 1q23.2 |
Refseq ORF | 1179 |
Synonyms | GIRK3; KIR3.3 |
Summary | Potassium channels are present in most mammalian cells, where they participate in a wide range of physiologic responses. The protein encoded by this gene is an integral membrane protein and inward-rectifier type potassium channel. The encoded protein, which has a greater tendency to allow potassium to flow into a cell rather than out of a cell, is controlled by G-proteins. It associates with another G-protein-activated potassium channel to form a heteromultimeric pore-forming complex. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Ion Channels: Potassium, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417612 | KCNJ9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417612 | Transient overexpression lysate of potassium inwardly-rectifying channel, subfamily J, member 9 (KCNJ9) |
CNY 3,080.00 |
|
PH316336 | KCNJ9 MS Standard C13 and N15-labeled recombinant protein (NP_004974) |
CNY 19,520.00 |