GLB1 (NM_000404) Human Recombinant Protein
CAT#: TP316106
Recombinant protein of human galactosidase, beta 1 (GLB1), transcript variant 1, 20 µg
View other "GLB1" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC216106 representing NM_000404
Red=Cloning site Green=Tags(s) MPGFLVRILLLLLVLLLLGPTRGLRNATQRMFEIDYSRDSFLKDGQPFRYISGSIHYSRVPRFYWKDRLL KMKMAGLNAIQTYVPWNFHEPWPGQYQFSEDHDVEYFLRLAHELGLLVILRPGPYICAEWEMGGLPAWLL EKESILLRSSDPDYLAAVDKWLGVLLPKMKPLLYQNGGPVITVQVENEYGSYFACDFDYLRFLQKRFRHH LGDDVVLFTTDGAHKTFLKCGALQGLYTTVDFGTGSNITDAFLSQRKCEPKGPLINSEFYTGWLDHWGQP HSTIKTEAVASSLYDILARGASVNLYMFIGGTNFAYWNGANSPYAAQPTSYDYDAPLSEAGDLTEKYFAL RNIIQKFEKVPEGPIPPSTPKFAYGKVTLEKLKTVGAALDILCPSGPIKSLYPLTFIQVKQHYGFVLYRT TLPQDCSNPAPLSSPLNGVHDRAYVAVDGIPQGVLERNNVITLNITGKAGATLDLLVENMGRVNYGAYIN DFKGLVSNLTLSSNILTDWTIFPLDTEDAVRSHLGGWGHRDSGHHDEAWAHNSSNYTLPAFYMGNFSIPS GIPDLPQDTFIQFPGWTKGQVWINGFNLGRYWPARGPQLTLFVPQHILMTSAPNTITVLELEWAPCSSDD PELCAVTFVDRPVIGSSVTYDHPSKPVEKRLMPPPPQKNKDSWLDHV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 75.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_000395 |
Locus ID | 2720 |
UniProt ID | P16278 |
Refseq Size | 2409 |
Cytogenetics | 3p22.3 |
Refseq ORF | 2030 |
Synonyms | EBP; ELNR1; MPS4B |
Summary | This gene encodes a member of the glycosyl hydrolase 35 family of proteins. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate the mature lysosomal enzyme. This enzyme catalyzes the hydrolysis of a terminal beta-linked galactose residue from ganglioside substrates and other glycoconjugates. Mutations in this gene may result in GM1-gangliosidosis and Morquio B syndrome. [provided by RefSeq, Nov 2015] |
Protein Families | Druggable Genome |
Protein Pathways | Galactose metabolism, Glycosaminoglycan degradation, Glycosphingolipid biosynthesis - ganglio series, Lysosome, Metabolic pathways, Other glycan degradation, Sphingolipid metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424740 | GLB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY424740 | Transient overexpression lysate of galactosidase, beta 1 (GLB1), transcript variant 1 |
CNY 3,080.00 |
|
PH300721 | GLB1 MS Standard C13 and N15-labeled recombinant protein (NP_001073279) |
CNY 19,520.00 |
|
PH316106 | GLB1 MS Standard C13 and N15-labeled recombinant protein (NP_000395) |
CNY 19,520.00 |
|
TP300721 | Recombinant protein of human galactosidase, beta 1 (GLB1), transcript variant 2, 20 µg |
CNY 2,900.00 |