MDA5 (IFIH1) (NM_022168) Human Recombinant Protein
CAT#: TP315661
Recombinant protein of human interferon induced with helicase C domain 1 (IFIH1), 20 µg
View other "MDA5" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Cited in 8 publications. |
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC215661 representing NM_022168
Red=Cloning site Green=Tags(s) MSNGYSTDENFRYLISCFRARVKMYIQVEPVLDYLTFLPAEVKEQIQRTVATSGNMQAVELLLSTLEKGV WHLGWTREFVEALRRTGSPLAARYMNPELTDLPSPSFENAHDEYLQLLNLLQPTLVDKLLVRDVLDKCME EELLTIEDRNRIAAAENNGNESGVRELLKRIVQKENWFSAFLNVLRQTGNNELVQELTGSDCSESNAEIE NLSQVDGPQVEEQLLSTTVQPNLEKEVWGMENNSSESSFADSSVVSESDTSLAEGSVSCLDESLGHNSNM GSDSGTMGSDSDEENVAARASPEPELQLRPYQMEVAQPALEGKNIIICLPTGSGKTRVAVYIAKDHLDKK KKASEPGKVIVLVNKVLLVEQLFRKEFQPFLKKWYRVIGLSGDTQLKISFPEVVKSCDIIISTAQILENS LLNLENGEDAGVQLSDFSLIIIDECHHTNKEAVYNNIMRHYLMQKLKNNRLKKENKPVIPLPQILGLTAS PGVGGATKQAKAEEHILKLCANLDAFTIKTVKENLDQLKNQIQEPCKKFAIADATREDPFKEKLLEIMTR IQTYCQMSPMSDFGTQPYEQWAIQMEKKAAKEGNRKERVCAEHLRKYNEALQINDTIRMIDAYTHLETFY NEEKDKKFAVIEDDSDEGGDDEYCDGDEDEDDLKKPLKLDETDRFLMTLFFENNKMLKRLAENPEYENEK LTKLRNTIMEQYTRTEESARGIIFTKTRQSAYALSQWITENEKFAEVGVKAHHLIGAGHSSEFKPMTQNE QKEVISKFRTGKINLLIATTVAEEGLDIKECNIVIRYGLVTNEIAMVQARGRARADESTYVLVAHSGSGV IERETVNDFREKMMYKAIHCVQNMKPEEYAHKILELQMQSIMEKKMKTKRNIAKHYKNNLSLITFLCKNC SVLACSGEDIHVIEKMHHVNMTPEFKELYIVRENKTLQKKCADYQINGEIICKCGQAWGTMMVHKGLDLP CLKIRNFVVVFKNNSTKKQYKKWVELPITFPNLDYSECCLFSDED myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 116.5 kDa |
Concentration | >0.1 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | ELISA capture for autoantibodies (PMID: 28487565) ELISA capture for autoantibodies (PMID: 28842784) |
Reference Data | |
RefSeq | NP_071451 |
Locus ID | 64135 |
UniProt ID | Q9BYX4 |
Refseq Size | 3434 |
Cytogenetics | 2q24.2 |
Refseq ORF | 3075 |
Synonyms | AGS7; Hlcd; IDDM19; MDA-5; MDA5; RLR-2; SGMRT1 |
Summary | IFIH1 encodes MDA5 which is an intracellular sensor of viral RNA that triggers the innate immune response. Sensing RNA length and secondary structure, MDA5 binds dsRNA oligonucleotides with a modified DExD/H-box helicase core and a C-terminal domain, thus leading to a proinflammatory response that includes interferons. It has been shown that Coronaviruses (CoVs) as well as various other virus families, are capable of evading the MDA5-dependent interferon response, thus impeding the activation of the innate immune response to infection. MDA5 has also been shown to play an important role in enhancing natural killer cell function in malaria infection. In addition to its protective role in antiviral responses, MDA5 has been implicated in autoimmune and autoinflammatory diseases such as type 1 diabetes, systemic lupus erythematosus, and Aicardi-Goutieres syndrome[provided by RefSeq, Jul 2020] |
Protein Pathways | RIG-I-like receptor signaling pathway |
Citations (8)
The use of this Proteins has been cited in the following citations: |
---|
Increased Serum Matrix Metalloproteinase-9 Levels are Associated with Anti-Jo1 but not Anti-MDA5 in Myositis Patients
,Liu, Y;Luo, H;Wang, L;Li, C;Liu, L;Huang, L;Liu, K;Liu, M;Gao, S;Xiao, Y;Zhu, H;Zuo, X;Li, QZ;Zhang, H;,
Aging Dis
,PubMed ID 31440381
[MDA5]
|
Neutrophil extracellular traps may contribute to interstitial lung disease associated with anti-MDA5 autoantibody positive dermatomyositis
,Peng, Y;Zhang, S;Zhao, Y;Liu, Y;Yan, B;,
Clin. Rheumatol.
,PubMed ID 28842784
[MDA5]
|
Chemokine profiles of interstitial pneumonia in patients with dermatomyositis: a case control study
,Oda, K;Kotani, T;Takeuchi, T;Ishida, T;Shoda, T;Isoda, K;Yoshida, S;Nishimura, Y;Makino, S;,
Sci Rep
,PubMed ID 28487565
[MDA5]
|
Increased Serum LIGHT Levels Correlate with Disease Progression and Severity of Interstitial Pneumonia in Patients with Dermatomyositis: A Case Control Study
,null,
PLoS ONE
,PubMed ID 26448572
[MDA5]
|
Anti-MDA5 autoantibodies in juvenile dermatomyositis identify a distinct clinical phenotype: a prospective cohort study
,Tansley, SL;Betteridge, ZE;Gunawardena, H;Jacques, TS;Owens, CM;Pilkington, C;Arnold, K;Yasin, S;Moraitis, E;Wedderburn, LR;McHugh, NJ;,
Arthritis Res. Ther. July 2014
,PubMed ID 24989778
[MDA5]
|
Pre-Treatment Ferritin Level and Alveolar-Arterial Oxygen Gradient Can Predict Mortality Rate Due to Acute/Subacute Interstitial Pneumonia in Dermatomyositis Treated by Cyclosporine A/Glucocorticosteroid Combination Therapy: A Case Control Study
,null,
PLoS ONE
,PubMed ID 24586910
[MDA5]
|
Anti-MDA5 Antibodies in a Large Mediterranean Population of Adults with Dermatomyositis
,null,
Journal of Immunology Research
,PubMed ID 24741583
[MDA5]
|
Anti-MDA5 Antibodies in a Large Mediterranean Population of Adults with Dermatomyositis
,Labrador-Horrillo, M;Martinez, MA;,
Journal of Immunology Research, Feb 2014.
[MDA5]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411723 | IFIH1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY411723 | Transient overexpression lysate of interferon induced with helicase C domain 1 (IFIH1) |
CNY 4,840.00 |
|
PH315661 | IFIH1 MS Standard C13 and N15-labeled recombinant protein (NP_071451) |
CNY 19,520.00 |