C1orf86 (FAAP20) (NM_182533) Human Recombinant Protein
CAT#: TP315561
Recombinant protein of human chromosome 1 open reading frame 86 (C1orf86), 20 µg
View other "C1orf86" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC215561 representing NM_182533
Red=Cloning site Green=Tags(s) MEAARRPRLGLSRRRPPPAGGPSGGRPWFLLGGDERERLWAELLRTVSPELILDHEVPSLPAFPGQEPRC GPEPTEVFTVGPKTFSWTPFPPDLWGPGRSYRLLHGAGGHLESPARSLPQRPAPDPCRAPRVEQQPSVEG AAALRSCPMCQKEFAPRLTQLDVDSHLAQCLAESTEDVTW myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 19.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_872339 |
Locus ID | 199990 |
UniProt ID | Q6NZ36 |
Refseq Size | 745 |
Cytogenetics | 1p36.33 |
Refseq ORF | 540 |
Synonyms | C1orf86; FP7162 |
Summary | Component of the Fanconi anemia (FA) complex required to recruit the FA complex to DNA interstrand cross-links (ICLs) and promote ICLs repair. Following DNA damage recognizes and binds 'Lys-63'-linked ubiquitin generated by RNF8 at ICLs and recruits other components of the FA complex. Promotes translesion synthesis via interaction with REV1.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405510 | C1orf86 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY405510 | Transient overexpression lysate of chromosome 1 open reading frame 86 (C1orf86), transcript variant 2 |
CNY 3,080.00 |
|
PH315561 | C1orf86 MS Standard C13 and N15-labeled recombinant protein (NP_872339) |
CNY 19,520.00 |
其它C1orf86产品